Western Blot (WB)
(Host: RabbitTarget Name: TSHRSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that TSHR is expressed in Jurkat)
Rabbit TSHR Polyclonal Antibody | anti-TSHR antibody
TSHR antibody - N-terminal region
Gene Names
TSHR; LGR3; CHNG1; hTSHR-I
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
TSHR; Polyclonal Antibody; TSHR antibody - N-terminal region; anti-TSHR antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
Sequence Length
253
Applicable Applications for anti-TSHR antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 77%; Rat: 79%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TSHR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TSHRSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that TSHR is expressed in Jurkat)
Western Blot (WB)
(Host: RabbitTarget Name: TSHRSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that TSHR is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-TSHR Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TSHR is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-TSHR Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TSHR is expressed in Jurkat)
Related Product Information for anti-TSHR antibody
This is a rabbit polyclonal antibody against TSHR. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Target Description: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Product Categories/Family for anti-TSHR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28kDa
NCBI Official Full Name
thyrotropin receptor isoform 2
NCBI Official Synonym Full Names
thyroid stimulating hormone receptor
NCBI Official Symbol
TSHR
NCBI Official Synonym Symbols
LGR3; CHNG1; hTSHR-I
NCBI Protein Information
thyrotropin receptor
Protein Family
NCBI Description
The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
Research Articles on TSHR
Similar Products
Product Notes
The TSHR (Catalog #AAA3206082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSHR antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TSHR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSHR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CHQEEDFRVT CKDIQRIPSL PPSTQTLKLI ETHLRTIPSH AFSNLPNISR. It is sometimes possible for the material contained within the vial of "TSHR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
