Rabbit anti-Human OR5T2 Polyclonal Antibody | anti-OR5T2 antibody

OR5T2 antibody - C-terminal region

Cat. Num. AAA3206071

• Gene Names: OR5T2; OR11-177
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: OR5T2; Polyclonal Antibody; OR5T2 antibody - C-terminal region; anti-OR5T2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
• Sequence Length: 359

• Applicable Applications for anti-OR5T2 antibody: Western Blot (WB)
• Homology: Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR5T2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OR5T2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Related Product Information for anti-OR5T2 antibody

This is a rabbit polyclonal antibody against OR5T2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Product Categories/Family for anti-OR5T2 antibody

Polyclonal; Membrane Protein; Signal Transduction; Membrane & Traffic; Tissue Specific & Cell Marker; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 52317142
• NCBI GeneID: 219464
• NCBI Accession #: NP_001004746
• NCBI GenBank Nucleotide #: NM_001004746
• UniProt Accession #: Q6IFC8; Q8NGG2
• Molecular Weight: 39kDa
• NCBI Official Full Name: olfactory receptor 5T2
• NCBI Official Synonym Full Names: olfactory receptor family 5 subfamily T member 2
• NCBI Official Symbol: OR5T2
• NCBI Official Synonym Symbols: OR11-177
• NCBI Protein Information: olfactory receptor 5T2
• Protein Family: Olfactory receptor

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]