Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: HEK-293Lanes :Lane 1: 10ug of hRAGE HEK-293 lysateLane 2: 10ug of mRAGE HEK-293 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:2500Gene Name :AGERSubmitted by :Barry Hudson)

Rabbit AGER Polyclonal Antibody | anti-AGER antibody

AGER antibody - N-terminal region

Gene Names
AGER; RAGE; SCARJ1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGER; Polyclonal Antibody; AGER antibody - N-terminal region; anti-AGER antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Specificity
The immunizing peptide sequence is 100% homologous to all four isoforms of AGER.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT
Sequence Length
342
Applicable Applications for anti-AGER antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AGER
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: HEK-293Lanes :Lane 1: 10ug of hRAGE HEK-293 lysateLane 2: 10ug of mRAGE HEK-293 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:2500Gene Name :AGERSubmitted by :Barry Hudson)

Western Blot (WB) (Sample Type: HEK-293Lanes :Lane 1: 10ug of hRAGE HEK-293 lysateLane 2: 10ug of mRAGE HEK-293 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:2500Gene Name :AGERSubmitted by :Barry Hudson)

Western Blot (WB)

(Host: MouseTarget Name: AGERSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: AGERSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: AGERSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AGERSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-AGER antibody
This is a rabbit polyclonal antibody against AGER. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
177
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
advanced glycosylation end product-specific receptor isoform 7
NCBI Official Synonym Full Names
advanced glycosylation end-product specific receptor
NCBI Official Symbol
AGER
NCBI Official Synonym Symbols
RAGE; SCARJ1
NCBI Protein Information
advanced glycosylation end product-specific receptor
UniProt Protein Name
Advanced glycosylation end product-specific receptor
UniProt Gene Name
AGER
UniProt Synonym Gene Names
RAGE
UniProt Entry Name
RAGE_HUMAN

NCBI Description

The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]

Uniprot Description

RAGE: Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF- alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Interacts with S100B, S100A1 and APP. Interacts with S100A12. Endothelial cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Motility/polarity/chemotaxis; Cell cycle regulation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: identical protein binding; protein binding; transmembrane receptor activity; receptor activity

Biological Process: cell surface receptor linked signal transduction; response to wounding; innate immune response; inflammatory response; neurite development; induction of positive chemotaxis; activation of NF-kappaB transcription factor

Research Articles on AGER

Similar Products

Product Notes

The AGER ager (Catalog #AAA3205865) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGER antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AGER can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGER ager for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLPAVGIQDE GIFRCQAMNR NGKETKSNYR VRVYQIPGKP EIVDSASELT. It is sometimes possible for the material contained within the vial of "AGER, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.