Rabbit anti-Human RNASEH2A Polyclonal Antibody | anti-RNASEH2A antibody

RNASEH2A antibody - C-terminal region

Cat. Num. AAA3205387

• Gene Names: RNASEH2A; AGS4; JUNB; RNHL; RNHIA; THSD8; RNASEHI
• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: RNASEH2A; Polyclonal Antibody; RNASEH2A antibody - C-terminal region; anti-RNASEH2A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
• Sequence Length: 299

• Applicable Applications for anti-RNASEH2A antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RNASEH2A AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Related Product Information for anti-RNASEH2A antibody

This is a rabbit polyclonal antibody against RNASEH2A. It was validated on Western Blot and immunohistochemistry

Target Description: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Product Categories/Family for anti-RNASEH2A antibody

Polyclonal; RNA Binding Proteins; Cell Cycle Proteins; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 38455391
• NCBI GeneID: 10535
• NCBI Accession #: NP_006388
• NCBI GenBank Nucleotide #: NM_006397
• UniProt Accession #: O75792; A0A1W2PP97
• Molecular Weight: 33kDa
• NCBI Official Full Name: ribonuclease H2 subunit A
• NCBI Official Synonym Full Names: ribonuclease H2 subunit A
• NCBI Official Symbol: RNASEH2A
• NCBI Official Synonym Symbols: AGS4; JUNB; RNHL; RNHIA; THSD8; RNASEHI
• NCBI Protein Information: ribonuclease H2 subunit A
• UniProt Protein Name: Ribonuclease H2 subunit A
• Protein Family: Ribonuclease
• UniProt Gene Name: RNASEH2A
• UniProt Synonym Gene Names: RNASEHI; RNHIA; RNase H2 subunit A; AGS4; RNase HI large subunit
• UniProt Entry Name: RNH2A_HUMAN

NCBI Description

The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to remove Okazaki fragment RNA primers during lagging strand DNA synthesis and to excise single ribonucleotides from DNA-DNA duplexes. Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS), a an autosomal recessive neurological disorder characterized by progressive microcephaly and psychomotor retardation, intracranial calcifications, elevated levels of interferon-alpha and white blood cells in the cerebrospinal fluid.[provided by RefSeq, Aug 2009]

Uniprot Description

RNASEH2A: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging- strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes. Defects in RNASEH2A are the cause of Aicardi-Goutieres syndrome type 4 (AGS4). A form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood. Belongs to the RNase HII family. Eukaryotic subfamily.

Protein type: Ribonuclease; EC 3.1.26.4; DNA replication

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleus

Molecular Function: RNA binding; metal ion binding; ribonuclease H activity; ribonuclease activity

Biological Process: mismatch repair; RNA catabolic process; DNA replication

Disease: Aicardi-goutieres Syndrome 4