Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: EIF2S1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit EIF2S1 Polyclonal Antibody | anti-EIF2S1 antibody

EIF2S1 antibody - N-terminal region

Gene Names
EIF2S1; EIF2; EIF-2; EIF2A; EIF-2A; EIF-2alpha
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF2S1; Polyclonal Antibody; EIF2S1 antibody - N-terminal region; anti-EIF2S1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
Sequence Length
315
Applicable Applications for anti-EIF2S1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: EIF2S1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: EIF2S1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-EIF2S1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-EIF2S1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)
Related Product Information for anti-EIF2S1 antibody
This is a rabbit polyclonal antibody against EIF2S1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
eukaryotic translation initiation factor 2 subunit 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2 subunit alpha
NCBI Official Symbol
EIF2S1
NCBI Official Synonym Symbols
EIF2; EIF-2; EIF2A; EIF-2A; EIF-2alpha
NCBI Protein Information
eukaryotic translation initiation factor 2 subunit 1
UniProt Protein Name
Eukaryotic translation initiation factor 2 subunit 1
UniProt Gene Name
EIF2S1
UniProt Synonym Gene Names
EIF2A; eIF-2-alpha; eIF-2A; eIF-2alpha
UniProt Entry Name
IF2A_HUMAN

NCBI Description

The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit (EIF2S2; MIM 603908), and the 52-kD EIF2-gamma subunit (EIF2S3; MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha (Ernst et al., 1987 [PubMed 2948954]).[supplied by OMIM, Feb 2010]

Uniprot Description

eIF2-alpha: a translation initiation factor that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40s ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B. Phosphorylated by at least 4 kinases: PERK, GCN2, HRI and PKR. Phosphorylation stabilizes the eIF-2/GDP/eIF-2B complex and prevents GDP/GTP exchange reaction, thus impairing the recycling of eIF-2 between successive rounds of initiation and leading to global inhibition of translation. Upregulated in some thyroid cancers and bronchiolo-alveolar adenocarcinomas; aberrant phosphorylation correlates with Alzheimer disease and Epstein-Barr virus infections.

Protein type: RNA-binding; Translation; Translation initiation

Chromosomal Location of Human Ortholog: 14q23.3

Cellular Component: eukaryotic translation initiation factor 2B complex; polysome; membrane; stress granule; cytosol; nucleus; eukaryotic translation initiation factor 2 complex

Molecular Function: protein binding; translation initiation factor activity; ribosome binding

Biological Process: regulation of translation initiation in response to stress; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; translation; unfolded protein response; protein amino acid autophosphorylation; translational initiation; gene expression

Research Articles on EIF2S1

Similar Products

Product Notes

The EIF2S1 eif2s1 (Catalog #AAA3205282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF2S1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2S1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF2S1 eif2s1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVVIRVDKEK GYIDLSKRRV SPEEAIKCED KFTKSKTVYS ILRHVAEVLE. It is sometimes possible for the material contained within the vial of "EIF2S1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.