Rabbit CSTF2 Polyclonal Antibody | anti-CSTF2 antibody

CSTF2 antibody - N-terminal region

Cat. Num. AAA3205164

• Gene Names: CSTF2; CstF-64
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: CSTF2; Polyclonal Antibody; CSTF2 antibody - N-terminal region; anti-CSTF2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
• Sequence Length: 577

• Applicable Applications for anti-CSTF2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 85%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSTF2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CSTF2 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-CSTF2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-CSTF2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-CSTF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateCSTF2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Related Product Information for anti-CSTF2 antibody

This is a rabbit polyclonal antibody against CSTF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-CSTF2 antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4557493
• NCBI GeneID: 1478
• NCBI Accession #: NP_001316
• NCBI GenBank Nucleotide #: NM_001325
• UniProt Accession #: P33240
• Molecular Weight: 61kDa
• NCBI Official Full Name: cleavage stimulation factor subunit 2 isoform 2
• NCBI Official Synonym Full Names: cleavage stimulation factor subunit 2
• NCBI Official Symbol: CSTF2
• NCBI Official Synonym Symbols: CstF-64
• NCBI Protein Information: cleavage stimulation factor subunit 2
• UniProt Protein Name: Cleavage stimulation factor subunit 2
• Protein Family: Cleavage stimulation factor
• UniProt Gene Name: CSTF2
• UniProt Synonym Gene Names: CSTF 64 kDa subunit; CstF-64
• UniProt Entry Name: CSTF2_HUMAN

NCBI Description

This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. [provided by RefSeq, Jul 2008]

Uniprot Description

CSTF2: One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: nucleoplasm; mRNA cleavage and polyadenylation specificity factor complex; nucleus

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; RNA splicing; mRNA polyadenylation; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription; mRNA cleavage