Immunohistochemistry (IHC)
(Immunohistochemistry with Liver tissue at an antibody concentration of 10ug/ml using anti-INSIG1 antibody )
Rabbit INSIG1 Polyclonal Antibody | anti-INSIG1 antibody
INSIG1 antibody - middle region
Gene Names
INSIG1; CL6
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
INSIG1; Polyclonal Antibody; INSIG1 antibody - middle region; anti-INSIG1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
Sequence Length
330
Applicable Applications for anti-INSIG1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human INSIG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Liver tissue at an antibody concentration of 10ug/ml using anti-INSIG1 antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Liver tissue at an antibody concentration of 10ug/ml using anti-INSIG1 antibody )
Western Blot (WB)
(Lanes:Lane1: 50 ug human putamen lysateLane2: 50 ug rat cortex lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Mouse anti-rabbit HRPSecondary Antibody Dilution:1:15000Gene Name:INSIG1Submitted by:Anonymous)
Western Blot (WB)
(Lanes:Lane1: 50 ug human putamen lysateLane2: 50 ug rat cortex lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Mouse anti-rabbit HRPSecondary Antibody Dilution:1:15000Gene Name:INSIG1Submitted by:Anonymous)
Western Blot (WB)
(WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Western Blot (WB)
(WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-INSIG1 antibody
This is a rabbit polyclonal antibody against INSIG1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote
Target Description: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote
Product Categories/Family for anti-INSIG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36kDa
NCBI Official Full Name
insulin-induced gene 1 protein isoform 2
NCBI Official Synonym Full Names
insulin induced gene 1
NCBI Official Symbol
INSIG1
NCBI Official Synonym Symbols
CL6
NCBI Protein Information
insulin-induced gene 1 protein
Protein Family
NCBI Description
This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Research Articles on INSIG1
Similar Products
Product Notes
The INSIG1 (Catalog #AAA3205034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INSIG1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's INSIG1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the INSIG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITIAFLATLI TQFLVYNGVY QYTSPDFLYI RSWLPCIFFS GGVTVGNIGR. It is sometimes possible for the material contained within the vial of "INSIG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
