Western Blot (WB)
(WB Suggested Anti-RHOXF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit anti-Human RHOXF1 Polyclonal Antibody | anti-RHOXF1 antibody
RHOXF1 antibody - C-terminal region
Gene Names
RHOXF1; OTEX; PEPP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHOXF1; Polyclonal Antibody; RHOXF1 antibody - C-terminal region; anti-RHOXF1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM
Sequence Length
184
Applicable Applications for anti-RHOXF1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOXF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RHOXF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-RHOXF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-RHOXF1 antibody
This is a rabbit polyclonal antibody against RHOXF1. It was validated on Western Blot
Target Description: RHOXF1 may be a transcription factor involved in reproductive processes.
Target Description: RHOXF1 may be a transcription factor involved in reproductive processes.
Product Categories/Family for anti-RHOXF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
rhox homeobox family member 1
NCBI Official Synonym Full Names
Rhox homeobox family member 1
NCBI Official Symbol
RHOXF1
NCBI Official Synonym Symbols
OTEX; PEPP1
NCBI Protein Information
rhox homeobox family member 1
UniProt Protein Name
Rhox homeobox family member 1
Protein Family
UniProt Gene Name
RHOXF1
UniProt Synonym Gene Names
OTEX; PEPP1
UniProt Entry Name
RHXF1_HUMAN
NCBI Description
This gene is a member of the PEPP subfamily of paired-like homoebox genes. The gene may be regulated by androgens and epigenetic mechanisms. The encoded nuclear protein is likely a transcription factor that may play a role in human reproduction. [provided by RefSeq, Dec 2012]
Research Articles on RHOXF1
Similar Products
Product Notes
The RHOXF1 rhoxf1 (Catalog #AAA3204863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOXF1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOXF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOXF1 rhoxf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELESVFRHTQ YPDVPTRREL AENLGVTEDK VRVWFKNKRA RCRRHQRELM. It is sometimes possible for the material contained within the vial of "RHOXF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
