Mouse anti-Human RHOXF1 Polyclonal Antibody | anti-RHOXF1 antibody

RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033)

Cat. Num. AAA645412

• Gene Names: RHOXF1; OTEX; PEPP1
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RHOXF1; Polyclonal Antibody; RHOXF1 (OTEX; PEPP1; Rhox Homeobox Family Member 1; Ovary-; Testis- and Epididymis-expressed Gene Protein; Paired-like Homeobox Protein PEPP-1; MGC119030; MGC119033); Anti -RHOXF1 (OTEX; anti-RHOXF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RHOXF1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD

• Applicable Applications for anti-RHOXF1 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human RHOXF1, aa1-184 (NP_644811.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOXF1 expression in transfected 293T cell line by RHOXF1 polyclonal antibody. Lane 1: OTEX transfected lysate (20.24kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to OTEX on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-RHOXF1 antibody

RHOXF1 may be a transcription factor involved in reproductive processes.

Product Categories/Family for anti-RHOXF1 antibody

Antibodies; Abs to Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 23943886
• NCBI GeneID: 158800
• NCBI Accession #: NP_644811.1
• NCBI GenBank Nucleotide #: NM_139282.2
• UniProt Accession #: Q8NHV9; O95030; Q3SYE0
• Molecular Weight: 20,542 Da
• NCBI Official Full Name: rhox homeobox family member 1
• NCBI Official Synonym Full Names: Rhox homeobox family, member 1
• NCBI Official Symbol: RHOXF1
• NCBI Official Synonym Symbols: OTEX; PEPP1
• NCBI Protein Information: rhox homeobox family member 1; PEPP subfamily gene 1; paired-like homeobox protein PEPP-1; ovary-, testis- and epididymis-expressed gene protein
• UniProt Protein Name: Rhox homeobox family member 1
• Protein Family: Rhox homeobox family
• UniProt Gene Name: RHOXF1
• UniProt Synonym Gene Names: OTEX; PEPP1
• UniProt Entry Name: RHXF1_HUMAN

NCBI Description

This gene is a member of the PEPP subfamily of paired-like homoebox genes. The gene may be regulated by androgens and epigenetic mechanisms. The encoded nuclear protein is likely a transcription factor that may play a role in human reproduction. [provided by RefSeq, Dec 2012]

Uniprot Description

RHOXF1: May be a transcription factor involved in reproductive processes. Belongs to the paired-like homeobox family. PEPP subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: steroid hormone receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; sexual reproduction; gamete generation; multicellular organismal development