Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MEOX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit MEOX2 Polyclonal Antibody | anti-MEOX2 antibody

MEOX2 antibody - N-terminal region

Gene Names
MEOX2; GAX; MOX2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MEOX2; Polyclonal Antibody; MEOX2 antibody - N-terminal region; anti-MEOX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII
Sequence Length
303
Applicable Applications for anti-MEOX2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MEOX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MEOX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-MEOX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-MEOX2 antibody
This is a rabbit polyclonal antibody against MEOX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
homeobox protein MOX-2
NCBI Official Synonym Full Names
mesenchyme homeobox 2
NCBI Official Symbol
MEOX2
NCBI Official Synonym Symbols
GAX; MOX2
NCBI Protein Information
homeobox protein MOX-2
UniProt Protein Name
Homeobox protein MOX-2
Protein Family
UniProt Gene Name
MEOX2
UniProt Synonym Gene Names
GAX; MOX2
UniProt Entry Name
MEOX2_HUMAN

NCBI Description

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease. [provided by RefSeq, Jul 2008]

Uniprot Description

MEOX2: Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. May have a regulatory role when quiescent vascular smooth muscle cells reenter the cell cycle.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 7p22.1-p21.3

Cellular Component: cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: limb development; skeletal muscle development; somite specification; transcription, DNA-dependent; blood circulation; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; palate development; angiogenesis

Research Articles on MEOX2

Similar Products

Product Notes

The MEOX2 meox2 (Catalog #AAA3204230) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEOX2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MEOX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEOX2 meox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEHPLFGCLR SPHATAQGLH PFSQSSLALH GRSDHMSYPE LSTSSSSCII. It is sometimes possible for the material contained within the vial of "MEOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.