Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Nr2c1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Nr2c1 Polyclonal Antibody | anti-NR2C1 antibody

Nr2c1 Antibody - middle region

Gene Names
Nr2c1; TR2; 80.3; Eenr; Tr2-11; 4831444H07Rik
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nr2c1; Polyclonal Antibody; Nr2c1 Antibody - middle region; anti-NR2C1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDL
Sequence Length
256
Applicable Applications for anti-NR2C1 antibody
Western Blot (WB)
Homology
Dog: 87%; Horse: 87%; Human: 93%; Mouse: 93%; Rabbit: 80%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of MOUSE Nr2c1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Nr2c1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Nr2c1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NR2C1 antibody
This is a rabbit polyclonal antibody against Nr2c1. It was validated on Western Blot

Target Description: Nr2c1 is an orphan nuclear receptor. Nr2c1 represses transcription and binds DNA as a homodimer. Nr2c1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism.
Product Categories/Family for anti-NR2C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group C member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 2, group C, member 1
NCBI Official Symbol
Nr2c1
NCBI Official Synonym Symbols
TR2; 80.3; Eenr; Tr2-11; 4831444H07Rik
NCBI Protein Information
nuclear receptor subfamily 2 group C member 1
UniProt Protein Name
Nuclear receptor subfamily 2 group C member 1
UniProt Gene Name
Nr2c1
UniProt Synonym Gene Names
Tr2; Tr2-11; mTR2
UniProt Entry Name
NR2C1_MOUSE

Uniprot Description

Function: Orphan nuclear receptor. Binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. Primarily repressor of a broad range of genes including ESR1 and RARB. Together with NR2C2, forms the core of the DRED (direct repeat erythroid-definitive) complex that represses embryonic and fetal globin transcription. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA-3' half site direct repeat consensus sequences

By similarity. Also activator of OCT4 gene expression. Plays a fundamental role in early embryogenesis and regulates embryonic stem cell proliferation and differentiation. Mediator of retinoic acid-regulated preadipocyte proliferation. Ref.2 Ref.3 Ref.10 Ref.12 Ref.13 Ref.14 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.23

Subunit structure: Homodimer. Heterodimer; with NR2C2 which is required for chromatin remodeling and for binding to promoter regions such as globin DR1 repeats. Interacts with ESR1; the interaction prevents homodimerization of ESR1 and suppresses its transcriptional activity and cell growth

By similarity. Interacts with NRIP1 (via its LXXLL motifs); the interaction provides corepressor activity. Interacts with HDAC3 (via the DNA-binding domain); the interaction recruits phosphorylated NR2C1 to PML bodies for sumoylation. Interacts with HDAC4 (via the DNA-binding domain). Interacts with PIAS1; the interaction is required for sumoylation of NR2C1. Interacts with UBE2I; the interaction is required for sumoylation of NR2C1. Interacts with KAT2B; the interaction acts as a corepressor of gene expression. Ref.11 Ref.12 Ref.13 Ref.14 Ref.17 Ref.18 Ref.19 Ref.20 Ref.22 Ref.24

Subcellular location: Nucleus. Nucleus › PML body. Note: Recruited by HDAC3, after all-trans retinoic acid stimulated MAPK1-mediated Thr-210 phosphorylation, to PML bodies for subsequent sumoylation. Ref.12 Ref.14 Ref.20 Ref.24

Tissue specificity: Isoform 1 is highly expressed in the adlumenal compartment of the seminiferous tubule of adult testes (at protein level) and in the eyes of newborn animals. Weakly expressed in other adult organs including the seminal vesicle, prostate, ovary, adrenal gland, heart, thymus, placenta and brain. Expressed during embryonic stages in developing eyes, brain and cartilage primordia (at protein level). Also expressed in the developing spinal motor neurons and in the sympathetic-, parasympathetic- and sensory ganglia of the embryonic PNS. Expressed in the developing neural epithelia of the inner ear, nasal cavity, tongue and retina. At day 16.5, expressed in various tissues including kidney and intestine. In contrast, isoform 2 is widely expressed at a low level throughout the adult testis. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.10 Ref.15

Developmental stage: Isoform 1 is highly expressed in early to midgestation embryos, with expression leveling off at 15 dpc. Expressed in yolk sac erythrocytes at 9.5 dpc. After birth, expression in the testes remains at a basal level until puberty, begins to increase at postnatal day 16 (P16) and peaks at P20 to P24. Expression is maintained at a high level throughout adulthood. Isoform 2 peaks transiently at P24. Ref.1 Ref.2 Ref.3 Ref.14

Induction: By ciliary neurotrophic factor (CNTF). Repressed by vitamin A. Induced by retinoic acid. Ref.1 Ref.5 Ref.23

Post-translational modification: Sumoylation requires both PIAS1 and UBE2I. Sumoylation appears to dissociate NR2C1 from the PML nuclear bodies. Enhances the interaction with NRIP1 but inhibits interaction with KAT2B. In proliferating cells, stimulation by all-trans retinoic acid, activation of MAPK1-mediated phosphorylation and recruitment to PML bodies with subsequent sumoylation, suppresses OCT4 expression. Ref.20 Ref.22 Ref.24Phosphorylated on several serine and threonine residues. Phosphorylation on Thr-210, stimulated by all-trans retinoic acid (atRA) mediates PML location and sumoylation in proliferating cells which then modulates its association with effector molecules, KAT2B and NRIP1. Phosphorylation on Ser-568 by PKC is important for protein stability and function as activator of RARB. Ref.16 Ref.17 Ref.22

Disruption phenotype: No visible phenotype. Mice exhibit normal spermatogenesis and testis development, as well as normal central nervous system development. NR2C1 and NR2C2 double null mutants result in early embryonic lethality and increased apoptosis. Embryos die around 7.5 dpc. Ref.15 Ref.23

Sequence similarities: Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.

Research Articles on NR2C1

Similar Products

Product Notes

The NR2C1 nr2c1 (Catalog #AAA3203808) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nr2c1 Antibody - middle region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Nr2c1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR2C1 nr2c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSTPGKVFLT TPDAAGVNQL FFTSPDLSAP HLQLLTEKSP DQGPNKVFDL. It is sometimes possible for the material contained within the vial of "Nr2c1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.