Western Blot (WB)
(WB Suggested Anti-ALX3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Rabbit ALX3 Polyclonal Antibody | anti-ALX3 antibody
ALX3 antibody - N-terminal region
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ALX3; Polyclonal Antibody; ALX3 antibody - N-terminal region; anti-ALX3 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR
Sequence Length
343
Applicable Applications for anti-ALX3 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 77%; Human: 79%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ALX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ALX3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ALX3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-ALX3 antibody
This is a rabbit polyclonal antibody against ALX3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Mouse Alx3 is a homeobox gene that is related to the Drosophila aristaless gene and to a group of vertebrate genes including Prx1, Prx2, Cart1, and Alx4. The protein encoded contains a diverged variant of a conserved peptide sequence present near the carboxyl terminus of at least 15 different paired-class-homeodomain proteins. Alx3 is expressed in mouse embryos from 8 days of gestation onward in a characteristic pattern, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm.
Target Description: Mouse Alx3 is a homeobox gene that is related to the Drosophila aristaless gene and to a group of vertebrate genes including Prx1, Prx2, Cart1, and Alx4. The protein encoded contains a diverged variant of a conserved peptide sequence present near the carboxyl terminus of at least 15 different paired-class-homeodomain proteins. Alx3 is expressed in mouse embryos from 8 days of gestation onward in a characteristic pattern, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm.
Product Categories/Family for anti-ALX3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
homeobox protein aristaless-like 3
NCBI Official Synonym Full Names
aristaless-like homeobox 3
NCBI Official Symbol
Alx3
NCBI Protein Information
homeobox protein aristaless-like 3
UniProt Protein Name
Homeobox protein aristaless-like 3
Protein Family
UniProt Gene Name
Alx3
NCBI Description
This gene belongs to Group 1 of aristaless-like genes, which are characterized by the presence of an aristaless domain and a conserved paired-like homeodomain. The encoded protein acts as a transcriptional regulator. The protein plays a role in the development of craniofacial and appendicular skeleton and may have a role in pancreatic function. [provided by RefSeq, Apr 2013]
Uniprot Description
Transcriptional regulator with a possible role in patterning of mesoderm during development.
Research Articles on ALX3
Similar Products
Product Notes
The ALX3 alx3 (Catalog #AAA3203789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALX3 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALX3 alx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPERCAPFS VGPAAGPYAA AGDEAPGPQG TPDAAPHLHP APPRGPRLSR. It is sometimes possible for the material contained within the vial of "ALX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
