Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CSNK1G1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Rabbit CSNK1G1 Polyclonal Antibody | anti-CSNK1G1 antibody

CSNK1G1 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CSNK1G1; Polyclonal Antibody; CSNK1G1 antibody - middle region; anti-CSNK1G1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW
Sequence Length
459
Applicable Applications for anti-CSNK1G1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CSNK1G1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CSNK1G1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-CSNK1G1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-CSNK1G1 antibody
This is a rabbit polyclonal antibody against CSNK1G1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CSNK1g1 is involved in regulation of fast synaptic transmission mediated by glutamate, the major excitatory neurotransmitter in the brain.
Product Categories/Family for anti-CSNK1G1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
casein kinase I isoform gamma-1
UniProt Protein Name
Casein kinase I isoform gamma-1
Protein Family
UniProt Gene Name
Csnk1g1
UniProt Synonym Gene Names
CKI-gamma 1

Uniprot Description

CK1G1: an ubiquitous protein kinase of the CK1 family. Involved in growth and morphogenesis. Two splice variant isoforms have been described.

Protein type: CK1 group; CK1 family; EC 2.7.11.1; Kinase, protein; Protein kinase, CK1; Protein kinase, Ser/Thr (non-receptor)

Chromosomal Location of Human Ortholog: 9|9 C

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: ATP binding; kinase activity; magnesium ion binding; nucleotide binding; peptide binding; phosphoprotein binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity

Biological Process: endocytosis; peptidyl-serine phosphorylation; phosphorylation; protein amino acid phosphorylation; protein autophosphorylation; regulation of cell shape; Wnt signaling pathway

Similar Products

Product Notes

The CSNK1G1 csnk1g1 (Catalog #AAA3203634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK1G1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1G1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSNK1G1 csnk1g1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CENFPEEMAT YLRYVRRLDF FEKPDYEYLR TLFTDLFERK GYTFDYAYDW. It is sometimes possible for the material contained within the vial of "CSNK1G1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.