Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Mouse Liver )

Rabbit anti-Mouse NR1I3 Polyclonal Antibody | anti-NR1I3 antibody

NR1I3 antibody - C-terminal region

Gene Names
Nr1i3; CAR; MB67; Care2; ESTM32; AA209988; AI551208; CAR-beta
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NR1I3; Polyclonal Antibody; NR1I3 antibody - C-terminal region; anti-NR1I3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
Sequence Length
358
Applicable Applications for anti-NR1I3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse NR1I3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Mouse Liver )

Immunohistochemistry (IHC) (Mouse Liver )

Western Blot (WB)

(WB Suggested Anti-NR1I3 Antibody Titration: 5.0ug/mlPositive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-NR1I3 Antibody Titration: 5.0ug/mlPositive Control: SP2/0 cell lysate)
Related Product Information for anti-NR1I3 antibody
This is a rabbit polyclonal antibody against NR1I3. It was validated on Western Blot and immunohistochemistry

Target Description: NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
nuclear receptor subfamily 1 group I member 3 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1, group I, member 3
NCBI Official Symbol
Nr1i3
NCBI Official Synonym Symbols
CAR; MB67; Care2; ESTM32; AA209988; AI551208; CAR-beta
NCBI Protein Information
nuclear receptor subfamily 1 group I member 3
UniProt Protein Name
Nuclear receptor subfamily 1 group I member 3
UniProt Gene Name
Nr1i3
UniProt Synonym Gene Names
Car; CAR
UniProt Entry Name
NR1I3_MOUSE

Uniprot Description

NR1I3: Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element. Interacts with ECT2. Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90. By dexamethasone. Predominantly expressed in liver. Belongs to the nuclear hormone receptor family. NR1 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor; DNA-binding

Cellular Component: nucleoplasm; cytoskeleton; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; metal ion binding; steroid hormone receptor activity; thyroid hormone receptor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription, DNA-dependent; regulation of transcription, DNA-dependent; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on NR1I3

Similar Products

Product Notes

The NR1I3 nr1i3 (Catalog #AAA3203424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1I3 antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NR1I3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NR1I3 nr1i3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQSRLQSRFL YAKLMGLLAD LRSINNAYSY ELQRLEELSA MTPLLGEICS. It is sometimes possible for the material contained within the vial of "NR1I3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.