Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARNTSample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ARNT Polyclonal Antibody | anti-ARNT antibody

ARNT Antibody - middle region

Gene Names
ARNT; HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARNT; Polyclonal Antibody; ARNT Antibody - middle region; anti-ARNT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLT
Sequence Length
416
Applicable Applications for anti-ARNT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARNT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARNTSample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARNTSample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ARNT antibody
This is a rabbit polyclonal antibody against ARNT. It was validated on Western Blot

Target Description: This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ARNT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
405
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
aryl hydrocarbon receptor nuclear translocator isoform 4
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator
NCBI Official Symbol
ARNT
NCBI Official Synonym Symbols
HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator
UniProt Gene Name
ARNT
UniProt Synonym Gene Names
BHLHE2; ARNT protein; bHLHe2; HIF-1-beta; HIF1-beta
UniProt Entry Name
ARNT_HUMAN

NCBI Description

This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]

Uniprot Description

ARNT: a bHLH transcription factor that requires dimerization with another bHLH protein for efficient DNA binding. A binding partner for the Ah (dioxin) nuclear receptor. Required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. A binding partner for HIF1A or HIF2A, transcription factors that regulates transcription from RNA polymerase II promoter in the adaptive response to hypoxia and oxidative stress. This complex activates target genes that limit oxygen consumption. HIF-1alpha may have nontranscriptional activities that inhibit DNA replication and cell proliferation when oxygen becomes scarce. Forms heterodimers with other bHLH proteins. Interacts with TACC3. Three isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Nuclear receptor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; aryl hydrocarbon receptor binding; protein heterodimerization activity; sequence-specific DNA binding; transcription coactivator activity; aryl hydrocarbon receptor activity; transcription factor binding; transcription factor activity

Biological Process: embryonic placenta development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of erythrocyte differentiation; mRNA transcription from RNA polymerase II promoter; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of protein sumoylation; positive regulation of hormone biosynthetic process; positive regulation of glycolysis; response to hypoxia; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; cell differentiation; regulation of transcription from RNA polymerase II promoter in response to oxidative stress

Research Articles on ARNT

Similar Products

Product Notes

The ARNT arnt (Catalog #AAA3203186) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARNT Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARNT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARNT arnt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSSADKERLA RENHSEIERR RRNKMTAYIT ELSDMVPTCS ALARKPDKLT. It is sometimes possible for the material contained within the vial of "ARNT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.