Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.)

Rabbit IFIH1 Polyclonal Antibody | anti-IFIH1 antibody

IFIH1 antibody - middle region

Gene Names
IFIH1; AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IFIH1; Polyclonal Antibody; IFIH1 antibody - middle region; anti-IFIH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
Sequence Length
1025
Applicable Applications for anti-IFIH1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Pig: 77%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.)

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.)

Western Blot (WB)

(Lanes:1: 20ug HEK293T no transfection, 2: 20ug HEK293T 3DYKDDDDK-MDA5/IFIH1Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:IFIH1Submitted by:Dr. Safia Deddouche, London Research InstituteIFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Lanes:1: 20ug HEK293T no transfection, 2: 20ug HEK293T 3DYKDDDDK-MDA5/IFIH1Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:IFIH1Submitted by:Dr. Safia Deddouche, London Research InstituteIFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-IFIH1 antibody
This is a rabbit polyclonal antibody against IFIH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
interferon-induced helicase C domain-containing protein 1
NCBI Official Synonym Full Names
interferon induced with helicase C domain 1
NCBI Official Symbol
IFIH1
NCBI Official Synonym Symbols
AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
NCBI Protein Information
interferon-induced helicase C domain-containing protein 1
UniProt Protein Name
Interferon-induced helicase C domain-containing protein 1
UniProt Gene Name
IFIH1
UniProt Synonym Gene Names
MDA5; RH116; CADM-140 autoantigen; Helicard; MDA-5; RLR-2
UniProt Entry Name
IFIH1_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19. [provided by RefSeq, Jul 2012]

Uniprot Description

IFIH1: Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include mRNA lacking 2'-O- methylation at their 5' cap and long-dsRNA (>1 kb in length). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV) and mengo encephalomyocarditis virus (ENMG). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines. Monomer in the absence of ligands and homodimerizes in the presence of dsRNA ligands. Can assemble into helical or linear polymeric filaments on long dsRNA. Interacts with MAVS/IPS1. Interacts with V protein of Simian virus 5, Human parainfluenza virus 2, Mumps virus, Sendai virus and Hendra virus. Binding to paramyxoviruses V proteins prevents IFN-beta induction, and the further establishment of an antiviral state. Interacts with PCBP2. Interacts with NLRC5. Interacts with PIAS2-beta. Interacts with DDX60. By interferon (IFN) and TNF. Widely expressed, at a low level. Expression is detected at slightly highest levels in placenta, pancreas and spleen and at barely levels in detectable brain, testis and lung. Belongs to the helicase family. RLR subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: nucleus; cytosol

Molecular Function: ribonucleoprotein binding; protein binding; single-stranded RNA binding; DNA binding; zinc ion binding; double-stranded RNA binding; helicase activity; ATP binding

Biological Process: regulation of apoptosis; protein sumoylation; detection of virus; viral reproduction; response to virus; positive regulation of interferon-beta production; innate immune response; negative regulation of interferon type I production; positive regulation of interferon-alpha production

Disease: Aicardi-goutieres Syndrome 7; Singleton-merten Syndrome 1

Research Articles on IFIH1

Similar Products

Product Notes

The IFIH1 ifih1 (Catalog #AAA3203158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFIH1 antibody - middle region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFIH1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the IFIH1 ifih1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QINDTIRMID AYTHLETFYN EEKDKKFAVI EDDSDEGGDD EYCDGDEDED. It is sometimes possible for the material contained within the vial of "IFIH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.