Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZP3 Antibody Titration: 0.6ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit ZP3 Polyclonal Antibody | anti-ZP3 antibody

ZP3 antibody - C-terminal region

Gene Names
ZP3; ZPC; ZP3A; ZP3B; Zp-3; OOMD3
Reactivity
Cow, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZP3; Polyclonal Antibody; ZP3 antibody - C-terminal region; anti-ZP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW
Sequence Length
424
Applicable Applications for anti-ZP3 antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZP3 Antibody Titration: 0.6ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ZP3 Antibody Titration: 0.6ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ZP3 antibody
This is a rabbit polyclonal antibody against ZP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
zona pellucida sperm-binding protein 3 isoform 1
NCBI Official Synonym Full Names
zona pellucida glycoprotein 3
NCBI Official Symbol
ZP3
NCBI Official Synonym Symbols
ZPC; ZP3A; ZP3B; Zp-3; OOMD3
NCBI Protein Information
zona pellucida sperm-binding protein 3
UniProt Protein Name
Zona pellucida sperm-binding protein 3
UniProt Gene Name
ZP3
UniProt Synonym Gene Names
ZP3A; ZP3B; ZPC; Zp-3
UniProt Entry Name
ZP3_HUMAN

NCBI Description

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ZP3: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation. Belongs to the ZP domain family. ZPC subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Extracellular matrix

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum; integral to membrane; acrosome; extracellular region; secretory granule; multivesicular body; extracellular matrix; proteinaceous extracellular matrix; perinuclear region of cytoplasm; cytoplasm; plasma membrane

Molecular Function: acrosin binding; signal transducer activity; protein binding; store-operated calcium channel activity; manganese ion transmembrane transporter activity; carbohydrate binding

Biological Process: positive regulation of type IV hypersensitivity; phosphoinositide-mediated signaling; binding of sperm to zona pellucida; positive regulation of transcription, DNA-dependent; positive regulation of leukocyte migration; manganese ion transport; blastocyst formation; positive regulation of phosphatidylinositol biosynthetic process; multicellular organism reproduction; positive regulation of interleukin-4 production; positive regulation of protein kinase B signaling cascade; humoral immune response mediated by circulating immunoglobulin; intracellular protein transport; positive regulation of interferon-gamma production; positive regulation of humoral immune response; positive regulation of protein kinase activity; single fertilization; positive regulation of T cell proliferation; negative regulation of transcription, DNA-dependent; oocyte development; positive regulation of inflammatory response

Research Articles on ZP3

Similar Products

Product Notes

The ZP3 zp3 (Catalog #AAA3202796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZP3 antibody - C-terminal region reacts with Cow, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZP3 zp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKGDCGTPSH SRRQPHVMSQ WSRSASRNRR HVTEEADVTV GATDLPGQEW. It is sometimes possible for the material contained within the vial of "ZP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.