Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Brain )

Rabbit CLCN3 Polyclonal Antibody | anti-CLCN3 antibody

CLCN3 antibody - C-terminal region

Gene Names
CLCN3; CLC3; ClC-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CLCN3; Polyclonal Antibody; CLCN3 antibody - C-terminal region; anti-CLCN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL
Sequence Length
866
Applicable Applications for anti-CLCN3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Brain )

Immunohistochemistry (IHC) (Human Brain )

Western Blot (WB)

(Host: RabbitTarget Name: CLCN3Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CLCN3Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CLCN3Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB) (Host: RabbitTarget Name: CLCN3Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB)

(WB Suggested Anti-CLCN3 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CLCN3 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-CLCN3 antibody
This is a rabbit polyclonal antibody against CLCN3. It was validated on Western Blot and immunohistochemistry

Target Description: CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
Product Categories/Family for anti-CLCN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
H(+)/Cl(-) exchange transporter 3
NCBI Official Synonym Full Names
chloride voltage-gated channel 3
NCBI Official Symbol
CLCN3
NCBI Official Synonym Symbols
CLC3; ClC-3
NCBI Protein Information
H(+)/Cl(-) exchange transporter 3
UniProt Protein Name
H(+)/Cl(-) exchange transporter 3
UniProt Gene Name
CLCN3
UniProt Synonym Gene Names
ClC-3
UniProt Entry Name
CLCN3_HUMAN

NCBI Description

This gene encodes a member of the voltage-gated chloride channel (ClC) family. The encoded protein is present in all cell types and localized in plasma membranes and in intracellular vesicles. It is a multi-pass membrane protein which contains a ClC domain and two additional C-terminal CBS (cystathionine beta-synthase) domains. The ClC domain catalyzes the selective flow of Cl- ions across cell membranes, and the CBS domain may have a regulatory function. This protein plays a role in both acidification and transmitter loading of GABAergic synaptic vesicles, and in smooth muscle cell activation and neointima formation. This protein is required for lysophosphatidic acid (LPA)-activated Cl- current activity and fibroblast-to-myofibroblast differentiation. The protein activity is regulated by Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) in glioma cells. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Research Articles on CLCN3

Similar Products

Product Notes

The CLCN3 clcn3 (Catalog #AAA3202619) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLCN3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CLCN3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CLCN3 clcn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGDAFGREGI YEAHIRLNGY PFLDAKEEFT HTTLAADVMR PRRNDPPLAV L. It is sometimes possible for the material contained within the vial of "CLCN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.