Rabbit P2RX2 Polyclonal Antibody | anti-P2RX2 antibody

P2RX2 antibody - N-terminal region

Cat. Num. AAA3202581

• Gene Names: P2RX2; P2X2; DFNA41
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: P2RX2; Polyclonal Antibody; P2RX2 antibody - N-terminal region; anti-P2RX2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI
• Sequence Length: 447

• Applicable Applications for anti-P2RX2 antibody: Western Blot (WB)
• Homology: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Related Product Information for anti-P2RX2 antibody

This is a rabbit polyclonal antibody against P2RX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Product Categories/Family for anti-P2RX2 antibody

Polyclonal; Ion Channel; Membrane Protein; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 531990826
• NCBI GeneID: 22953
• NCBI Accession #: NP_057402
• NCBI GenBank Nucleotide #: NM_016318
• UniProt Accession #: Q9UBL9
• Molecular Weight: 49kDa
• NCBI Official Full Name: P2X purinoceptor 2 isoform J
• NCBI Official Synonym Full Names: purinergic receptor P2X 2
• NCBI Official Symbol: P2RX2
• NCBI Official Synonym Symbols: P2X2; DFNA41
• NCBI Protein Information: P2X purinoceptor 2
• UniProt Protein Name: P2X purinoceptor 2
• Protein Family: P2X purinoceptor
• UniProt Gene Name: P2RX2
• UniProt Synonym Gene Names: P2X2; P2X2
• UniProt Entry Name: P2RX2_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

P2X2: Binding of this ligand-gated ion channel to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Belongs to the P2X receptor family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Channel, ligand-gated; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12q24.33

Cellular Component: apical plasma membrane; integral to nuclear inner membrane; integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: ATP binding; ATP-gated cation channel activity; identical protein binding; ligand-gated ion channel activity; purinergic nucleotide receptor activity

Biological Process: behavioral response to pain; blood coagulation; detection of hypoxic conditions in blood by carotid body chemoreceptors; neuromuscular junction development; neuromuscular synaptic transmission; peristalsis; positive regulation of calcium-mediated signaling; protein homooligomerization; response to ATP; response to carbohydrate stimulus; response to hypoxia; sensory perception of sound; sensory perception of taste; skeletal muscle fiber development; urinary bladder smooth muscle contraction

Disease: Deafness, Autosomal Dominant 41