Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CLCNKA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit CLCNKA Polyclonal Antibody | anti-CLCNKA antibody

CLCNKA antibody - N-terminal region

Gene Names
CLCNKA; CLCK1; ClC-K1; hClC-Ka
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLCNKA; Polyclonal Antibody; CLCNKA antibody - N-terminal region; anti-CLCNKA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
Sequence Length
687
Applicable Applications for anti-CLCNKA antibody
Western Blot (WB)
Homology
Cow: 90%; Human: 100%; Mouse: 85%; Pig: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CLCNKA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CLCNKA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CLCNKA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-CLCNKA antibody
This is a rabbit polyclonal antibody against CLCNKA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CLCNKA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
chloride channel protein ClC-Ka isoform 1
NCBI Official Synonym Full Names
chloride voltage-gated channel Ka
NCBI Official Symbol
CLCNKA
NCBI Official Synonym Symbols
CLCK1; ClC-K1; hClC-Ka
NCBI Protein Information
chloride channel protein ClC-Ka
UniProt Protein Name
Chloride channel protein ClC-Ka
Protein Family
UniProt Gene Name
CLCNKA
UniProt Synonym Gene Names
Chloride channel Ka
UniProt Entry Name
CLCKA_HUMAN

NCBI Description

This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CLCNKA: Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport. May be important in urinary concentrating mechanisms. Defects in CLCNKA are a cause of Bartter syndrome type 4B (BS4B). A digenic, recessive disorder characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. Bartter syndrome type 4B is associated with sensorineural deafness. Belongs to the chloride channel (TC 2.A.49) family. CLCNKA subfamily.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, ion channel

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: metal ion binding; voltage-gated chloride channel activity

Biological Process: transport; excretion; transmembrane transport

Disease: Bartter Syndrome, Type 4b

Research Articles on CLCNKA

Similar Products

Product Notes

The CLCNKA clcnka (Catalog #AAA3202441) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLCNKA antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLCNKA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLCNKA clcnka for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEELVGLREG FSGDPVTLQE LWGPCPHIRR AIQGGLEWLK QKVFRLGEDW. It is sometimes possible for the material contained within the vial of "CLCNKA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.