Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SCN7ASample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SCN7A Polyclonal Antibody | anti-SCN7A antibody

SCN7A Antibody - N-terminal region

Gene Names
SCN7A; NaG; SCN6A; Nav2.1; Nav2.2
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCN7A; Polyclonal Antibody; SCN7A Antibody - N-terminal region; anti-SCN7A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT
Sequence Length
762
Applicable Applications for anti-SCN7A antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 80%; Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SCN7A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SCN7ASample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SCN7ASample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SCN7A antibody
This is a rabbit polyclonal antibody against SCN7A. It was validated on Western Blot

Target Description: This gene encodes one of the many voltage-gated sodium channel proteins. For proper functioning of neurons and muscles during action potentials, voltage-gated sodium channels direct sodium ion diffusion for membrane depolarization. This sodium channel protein has some atypical characteristics; the similarity between the human and mouse proteins is lower compared to other orthologous sodium channel pairs. Also, the S4 segments, which sense voltage changes, have fewer positive charged residues that in other sodium channels; domain 4 has fewer arginine and lysine residues compared to other sodium channel proteins. Several alternatively spliced transcript variants exist, but the full-length natures of all of them remain unknown.
Product Categories/Family for anti-SCN7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
sodium channel protein type 7 subunit alpha
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 7
NCBI Official Symbol
SCN7A
NCBI Official Synonym Symbols
NaG; SCN6A; Nav2.1; Nav2.2
NCBI Protein Information
sodium channel protein type 7 subunit alpha
UniProt Protein Name
Sodium channel protein type 7 subunit alpha
Protein Family
UniProt Gene Name
SCN7A
UniProt Synonym Gene Names
SCN6A
UniProt Entry Name
SCN7A_HUMAN

NCBI Description

This gene encodes one of the many voltage-gated sodium channel proteins. For proper functioning of neurons and muscles during action potentials, voltage-gated sodium channels direct sodium ion diffusion for membrane depolarization. This sodium channel protein has some atypical characteristics; the similarity between the human and mouse proteins is lower compared to other orthologous sodium channel pairs. Also, the S4 segments, which sense voltage changes, have fewer positive charged residues that in other sodium channels; domain 4 has fewer arginine and lysine residues compared to other sodium channel proteins. Several alternatively spliced transcript variants exist, but the full-length natures of all of them remain unknown. [provided by RefSeq, Dec 2011]

Uniprot Description

SCN7A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Belongs to the sodium channel (TC 1.A.1.10) family. SCN7A subfamily.

Protein type: Membrane protein, multi-pass; Channel, sodium; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q21-q23

Cellular Component: voltage-gated sodium channel complex; plasma membrane

Molecular Function: voltage-gated sodium channel activity

Biological Process: muscle contraction; sodium ion transport; generation of action potential; sodium ion homeostasis

Research Articles on SCN7A

Similar Products

Product Notes

The SCN7A scn7a (Catalog #AAA3202434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCN7A Antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCN7A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCN7A scn7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFIYGNLSQG MVSEPLEDVD PYYYKKKNTF IVLNKNRTIF RFNAASILCT. It is sometimes possible for the material contained within the vial of "SCN7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.