Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)

Rabbit KCNA1 Polyclonal Antibody | anti-KCNA1 antibody

KCNA1 antibody - middle region

Gene Names
KCNA1; EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNA1; Polyclonal Antibody; KCNA1 antibody - middle region; anti-KCNA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Sequence Length
495
Applicable Applications for anti-KCNA1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-KCNA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Related Product Information for anti-KCNA1 antibody
This is a rabbit polyclonal antibody against KCNA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KCNA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 1
NCBI Official Symbol
KCNA1
NCBI Official Synonym Symbols
EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
NCBI Protein Information
potassium voltage-gated channel subfamily A member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 1
UniProt Gene Name
KCNA1
UniProt Entry Name
KCNA1_HUMAN

NCBI Description

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq, Jul 2008]

Uniprot Description

Kv1.1: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Defects in KCNA1 are the cause of episodic ataxia type 1 (EA1); also known as paroxysmal or episodic ataxia with myokymia (EAM) or paroxysmal ataxia with neuromyotonia. EA1 is an autosomal dominant disorder characterized by brief episodes of ataxia and dysarthria. Neurological examination during and between the attacks demonstrates spontaneous, repetitive discharges in the distal musculature (myokymia) that arise from peripheral nerve. Nystagmus is absent. Defects in KCNA1 are the cause of myokymia isolated type 1 (MK1). Myokymia is a condition characterized by spontaneous involuntary contraction of muscle fiber groups that can be observed as vermiform movement of the overlying skin. Electromyography typically shows continuous motor unit activity with spontaneous oligo- and multiplet-discharges of high intraburst frequency (myokymic discharges). Isolated spontaneous muscle twitches occur in many persons and have no grave significance. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily.

Protein type: Channel, potassium; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.32

Cellular Component: voltage-gated potassium channel complex; cell surface; endoplasmic reticulum; integral to plasma membrane; cytoplasmic membrane-bound vesicle; dendrite; paranode region of axon; integral to membrane; perikaryon; cytosol; presynaptic membrane; cell soma; apical plasma membrane; plasma membrane; synapse; nerve terminal; cell junction

Molecular Function: protein binding; voltage-gated potassium channel activity; potassium channel activity; delayed rectifier potassium channel activity; potassium ion transmembrane transporter activity

Biological Process: detection of mechanical stimulus involved in sensory perception of pain; synaptic transmission; regulation of membrane potential; regulation of muscle contraction; neuromuscular process; generation of action potential; protein homooligomerization; potassium ion transport; detection of mechanical stimulus involved in sensory perception of touch

Disease: Episodic Ataxia, Type 1

Research Articles on KCNA1

Similar Products

Product Notes

The KCNA1 kcna1 (Catalog #AAA3202360) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNA1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNA1 kcna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISIVIFCLET LPELKDDKDF TGTVHRIDNT TVIYNSNIFT DPFFIVETLC. It is sometimes possible for the material contained within the vial of "KCNA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.