Potassium voltage-gated channel subfamily A member 1 protein Recombinant Protein | KCNA1 recombinant protein

Recombinant human Potassium voltage-gated channel subfamily A member 1 protein

Cat. Num. AAA1265383

• Gene Names: KCNA1; EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium voltage-gated channel subfamily A member 1 protein; Recombinant human Potassium voltage-gated channel subfamily A member 1 protein; KCNA1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-154aa; Partial
• Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

Related Product Information for KCNA1 recombinant protein

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Product Categories/Family for KCNA1 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 119395748
• NCBI GeneID: 3736
• NCBI Accession #: NP_000208.2
• NCBI GenBank Nucleotide #: NM_000217.2
• UniProt Accession #: Q09470; Q3MIQ9; A6NM83
• Molecular Weight: 22.2 kDa
• NCBI Official Full Name: potassium voltage-gated channel subfamily A member 1
• NCBI Official Synonym Full Names: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
• NCBI Official Symbol: KCNA1
• NCBI Official Synonym Symbols: EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
• NCBI Protein Information: potassium voltage-gated channel subfamily A member 1; voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; voltage-gated potassium channel subunit Kv1.1
• UniProt Protein Name: Potassium voltage-gated channel subfamily A member 1
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: KCNA1
• UniProt Entry Name: KCNA1_HUMAN

NCBI Description

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq, Jul 2008]

Uniprot Description

Kv1.1: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Defects in KCNA1 are the cause of episodic ataxia type 1 (EA1); also known as paroxysmal or episodic ataxia with myokymia (EAM) or paroxysmal ataxia with neuromyotonia. EA1 is an autosomal dominant disorder characterized by brief episodes of ataxia and dysarthria. Neurological examination during and between the attacks demonstrates spontaneous, repetitive discharges in the distal musculature (myokymia) that arise from peripheral nerve. Nystagmus is absent. Defects in KCNA1 are the cause of myokymia isolated type 1 (MK1). Myokymia is a condition characterized by spontaneous involuntary contraction of muscle fiber groups that can be observed as vermiform movement of the overlying skin. Electromyography typically shows continuous motor unit activity with spontaneous oligo- and multiplet-discharges of high intraburst frequency (myokymic discharges). Isolated spontaneous muscle twitches occur in many persons and have no grave significance. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, potassium

Chromosomal Location of Human Ortholog: 12p13.32

Cellular Component: voltage-gated potassium channel complex; cell surface; endoplasmic reticulum; integral to plasma membrane; paranode region of axon; cytoplasmic membrane-bound vesicle; dendrite; integral to membrane; perikaryon; cytosol; presynaptic membrane; cell soma; apical plasma membrane; plasma membrane; synapse; nerve terminal; cell junction

Molecular Function: protein binding; voltage-gated potassium channel activity; potassium channel activity; delayed rectifier potassium channel activity; potassium ion transmembrane transporter activity

Biological Process: detection of mechanical stimulus involved in sensory perception of pain; synaptic transmission; regulation of membrane potential; regulation of muscle contraction; neuromuscular process; generation of action potential; protein homooligomerization; potassium ion transport; detection of mechanical stimulus involved in sensory perception of touch

Disease: Episodic Ataxia, Type 1