Western Blot (WB)
(WB Suggested Anti-TRIM39 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateTRIM39 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit TRIM39 Polyclonal Antibody | anti-TRIM39 antibody
TRIM39 antibody - N-terminal region
Gene Names
TRIM39; TFP; RNF23; TRIM39B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TRIM39; Polyclonal Antibody; TRIM39 antibody - N-terminal region; anti-TRIM39 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVE
Sequence Length
488
Applicable Applications for anti-TRIM39 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM39
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRIM39 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateTRIM39 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-TRIM39 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateTRIM39 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-TRIM39 antibody
This is a rabbit polyclonal antibody against TRIM39. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by TRIM39 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6.
Target Description: The protein encoded by TRIM39 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6.
Product Categories/Family for anti-TRIM39 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM39 isoform 2
NCBI Official Synonym Full Names
tripartite motif containing 39
NCBI Official Symbol
TRIM39
NCBI Official Synonym Symbols
TFP; RNF23; TRIM39B
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM39
Protein Family
NCBI Description
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6. Alternate splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Research Articles on TRIM39
Similar Products
Product Notes
The TRIM39 (Catalog #AAA3202266) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM39 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM39 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM39 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HTVVPLDDAT QEYKEKLQKC LEPLEQKLQE ITRCKSSEEK KPGELKRLVE. It is sometimes possible for the material contained within the vial of "TRIM39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
