Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (WB Suggested Anti-HNRNPA0 AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit RBBP9 Polyclonal Antibody | anti-RBBP9 antibody

RBBP9 Antibody

Gene Names
RBBP9; BOG; RBBP10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
RBBP9; Polyclonal Antibody; RBBP9 Antibody; anti-RBBP9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Sequence Length
186
Applicable Applications for anti-RBBP9 antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(WB Suggested Anti-HNRNPA0 AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)

Immunofluorescence (IF) (WB Suggested Anti-HNRNPA0 AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB)

(WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-RBBP9 antibody
This is a rabbit polyclonal antibody against RBBP9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Product Categories/Family for anti-RBBP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
putative hydrolase RBBP9
NCBI Official Synonym Full Names
RB binding protein 9, serine hydrolase
NCBI Official Symbol
RBBP9
NCBI Official Synonym Symbols
BOG; RBBP10
NCBI Protein Information
putative hydrolase RBBP9
UniProt Protein Name
Putative hydrolase RBBP9
Protein Family
UniProt Gene Name
RBBP9
UniProt Synonym Gene Names
BOG; RBBP10; Protein BOG; RBBP-10; RBBP-9
UniProt Entry Name
RBBP9_HUMAN

NCBI Description

The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq, Jul 2008]

Uniprot Description

RBBP9: May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1. Belongs to the RBBP9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.-.-.-

Chromosomal Location of Human Ortholog: 20p11.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: hydrolase activity

Biological Process: metabolic process; regulation of cell proliferation

Research Articles on RBBP9

Similar Products

Product Notes

The RBBP9 rbbp9 (Catalog #AAA3202230) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBBP9 Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RBBP9 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the RBBP9 rbbp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MASPSKAVIV PGNGGGDVTT HGWYGWVKKE LEKIPGFQCL AKNMPDPITA. It is sometimes possible for the material contained within the vial of "RBBP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.