Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Bmi1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Rabbit Bmi1 Polyclonal Antibody | anti-BMI1 antibody

Bmi1 antibody - middle region

Gene Names
Bmi1; Bmi-1; Pcgf4; AW546694
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Bmi1; Polyclonal Antibody; Bmi1 antibody - middle region; anti-BMI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK
Sequence Length
324
Applicable Applications for anti-BMI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Bmi1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Western Blot (WB) (WB Suggested Anti-Bmi1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-BMI1 antibody
This is a rabbit polyclonal antibody against Bmi1. It was validated on Western Blot

Target Description: Bmi1 is a component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Product Categories/Family for anti-BMI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
polycomb complex protein BMI-1
NCBI Official Synonym Full Names
Bmi1 polycomb ring finger oncogene
NCBI Official Symbol
Bmi1
NCBI Official Synonym Symbols
Bmi-1; Pcgf4; AW546694
NCBI Protein Information
polycomb complex protein BMI-1
UniProt Protein Name
Polycomb complex protein BMI-1
Protein Family
UniProt Gene Name
Bmi1
UniProt Synonym Gene Names
Bmi-1; Pcgf4
UniProt Entry Name
BMI1_MOUSE

Uniprot Description

BMI1: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. Component of a PRC1-like complex. Interacts with RING1 and RING2. Interacts vwith CBX7 and CBX8. Interacts with SPOP. Part of a complex consisting of BMI1, CUL3 and SPOP. Interacts with E4F1.

Protein type: EC 6.3.2.-; Oncoprotein; Ubiquitin ligase; Motility/polarity/chemotaxis; Ligase; Ubiquitin conjugating system

Cellular Component: heterochromatin; nuclear body; cytoplasm; PcG protein complex; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding; metal ion binding; chromatin binding

Biological Process: transcription, DNA-dependent; in utero embryonic development; embryonic skeletal development; positive regulation of immature T cell proliferation in the thymus; chromatin modification; negative regulation of transcription from RNA polymerase II promoter; humoral immune response; embryonic skeletal morphogenesis; rostrocaudal neural tube patterning; regulation of transcription, DNA-dependent; regulation of catalytic activity; histone ubiquitination; DNA methylation; positive regulation of B cell proliferation; somatic stem cell division; histone acetylation; brain development; skeletal development; cellular process

Research Articles on BMI1

Similar Products

Product Notes

The BMI1 bmi1 (Catalog #AAA3201653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bmi1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Bmi1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMI1 bmi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDIPNTFQID VMYEEEPLKD YYTLMDIAYI YTWRRNGPLP LKYRVRPTCK. It is sometimes possible for the material contained within the vial of "Bmi1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.