Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLE3 Antibody Titration: 2.5ug/mlPositive Control: Daudi cell lysatePOLE3 is supported by BioGPS gene expression data to be expressed in Daudi)

Rabbit POLE3 Polyclonal Antibody | anti-POLE3 antibody

POLE3 antibody - N-terminal region

Gene Names
POLE3; p17; YBL1; CHRAC2; CHRAC17; CHARAC17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
POLE3; Polyclonal Antibody; POLE3 antibody - N-terminal region; anti-POLE3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS
Sequence Length
147
Applicable Applications for anti-POLE3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POLE3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLE3 Antibody Titration: 2.5ug/mlPositive Control: Daudi cell lysatePOLE3 is supported by BioGPS gene expression data to be expressed in Daudi)

Western Blot (WB) (WB Suggested Anti-POLE3 Antibody Titration: 2.5ug/mlPositive Control: Daudi cell lysatePOLE3 is supported by BioGPS gene expression data to be expressed in Daudi)
Related Product Information for anti-POLE3 antibody
This is a rabbit polyclonal antibody against POLE3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
DNA polymerase epsilon subunit 3
NCBI Official Synonym Full Names
DNA polymerase epsilon 3, accessory subunit
NCBI Official Symbol
POLE3
NCBI Official Synonym Symbols
p17; YBL1; CHRAC2; CHRAC17; CHARAC17
NCBI Protein Information
DNA polymerase epsilon subunit 3
UniProt Protein Name
DNA polymerase epsilon subunit 3
Protein Family
UniProt Gene Name
POLE3
UniProt Synonym Gene Names
CHRAC17; AsTP; CHRAC-17; HuCHRAC17
UniProt Entry Name
DPOE3_HUMAN

NCBI Description

POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]

Uniprot Description

POLE3: Forms a complex with DNA polymerase epsilon subunit CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1.

Protein type: EC 2.7.7.7; DNA replication; Nucleotide Metabolism - purine; Transferase; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 9q33

Cellular Component: epsilon DNA polymerase complex; nucleus

Molecular Function: protein binding; protein heterodimerization activity; sequence-specific DNA binding; DNA-directed DNA polymerase activity

Biological Process: DNA replication

Similar Products

Product Notes

The POLE3 pole3 (Catalog #AAA3201298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLE3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLE3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLE3 pole3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAERPEDLNL PNAVITRIIK EALPDGVNIS KEARSAISRA ASVFVLYATS. It is sometimes possible for the material contained within the vial of "POLE3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.