Western Blot (WB)
(Western Blot analysis of POLE3 expression in transfected 293T cell line by POLE3 polyclonal antibody. Lane 1: POLE3 transfected lysate (16.9kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human POLE3 Polyclonal Antibody | anti-POLE3 antibody
POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (FITC)
Gene Names
POLE3; p17; YBL1; CHRAC17; CHARAC17
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLE3; Polyclonal Antibody; POLE3 (DNA Polymerase epsilon Subunit 3; Arsenic-transactivated Protein; AsTP; Chromatin Accessibility Complex 17kD Protein; CHRAC-17; HuCHRAC17; DNA Polymerase II Subunit 3; DNA Polymerase epsilon Subunit p17; CHRAC17) (FITC); anti-POLE3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human POLE3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-POLE3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human POLE3, aa1-147 (AAH03166.1).
Immunogen Sequence
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of POLE3 expression in transfected 293T cell line by POLE3 polyclonal antibody. Lane 1: POLE3 transfected lysate (16.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of POLE3 expression in transfected 293T cell line by POLE3 polyclonal antibody. Lane 1: POLE3 transfected lysate (16.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-POLE3 antibody
POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Product Categories/Family for anti-POLE3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
16,860 Da
NCBI Official Full Name
Homo sapiens polymerase (DNA directed), epsilon 3 (p17 subunit), mRNA
NCBI Official Synonym Full Names
DNA polymerase epsilon 3, accessory subunit
NCBI Official Symbol
POLE3
NCBI Official Synonym Symbols
p17; YBL1; CHRAC17; CHARAC17
NCBI Protein Information
DNA polymerase epsilon subunit 3
Protein Family
NCBI Description
POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]
Similar Products
Product Notes
The POLE3 (Catalog #AAA6390101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLE3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLE3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLE3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
