Western Blot (WB)
(WB Suggested Anti-FSBP Antibody Titration: 1.25ug/mlPositive Control: Human Stomach)
Rabbit FSBP Polyclonal Antibody | anti-FSBP antibody
FSBP antibody - N-terminal region
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
FSBP; Polyclonal Antibody; FSBP antibody - N-terminal region; anti-FSBP antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS
Sequence Length
299
Applicable Applications for anti-FSBP antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FSBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FSBP Antibody Titration: 1.25ug/mlPositive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-FSBP Antibody Titration: 1.25ug/mlPositive Control: Human Stomach)
Related Product Information for anti-FSBP antibody
This is a rabbit polyclonal antibody against FSBP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene, which is located on chromosome 8, is predicted to code a transcription factor with unknown fucntion.
Target Description: This gene, which is located on chromosome 8, is predicted to code a transcription factor with unknown fucntion.
Product Categories/Family for anti-FSBP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
UniProt Protein Name
Fibrinogen silencer-binding protein
Protein Family
UniProt Gene Name
FSBP
UniProt Entry Name
FSBP_HUMAN
Uniprot Description
FSBP: Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1. Interacts with APBA1 (via PDZ 1 and 2 domains). 2 isoforms of the human protein are produced by alternative splicing
Chromosomal Location of Human Ortholog: 8q22.1
Cellular Component: nucleus
Molecular Function: DNA helicase activity; DNA binding; DNA translocase activity; RNA helicase activity; ATP binding
Biological Process: mitotic recombination; meiotic recombination; DNA duplex unwinding; double-strand break repair via homologous recombination
Similar Products
Product Notes
The FSBP fsbp (Catalog #AAA3201162) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FSBP antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FSBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FSBP fsbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEYAKQELLQ QKETQSDFKS NISEPTKKVM EMIPQISSFC LVRDRNHIQS. It is sometimes possible for the material contained within the vial of "FSBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
