Rabbit PSMD14 Polyclonal Antibody | anti-PSMD14 antibody

PSMD14 antibody - C-terminal region

Cat. Num. AAA3200949

• Gene Names: PSMD14; PAD1; POH1; RPN11
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: PSMD14; Polyclonal Antibody; PSMD14 antibody - C-terminal region; anti-PSMD14 antibody

• Host: Rabbit
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
• Sequence Length: 310

• Applicable Applications for anti-PSMD14 antibody: Western Blot (WB)
• Homology: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PSMD14 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Lanes:1. 100 ug HeLa cell lysate2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S ProteasomePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit APSecondary Antibody Dilution:1:10000Gene Name:PSMD14Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePSMD14 is supported by BioGPS gene expression data to be expressed in HepG2)

Related Product Information for anti-PSMD14 antibody

This is a rabbit polyclonal antibody against PSMD14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway

Product Categories/Family for anti-PSMD14 antibody

Polyclonal; Transcription Factor; Drugs and Drug Metabolism; E3 & Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 5031981
• NCBI GeneID: 10213
• NCBI Accession #: NP_005796
• NCBI GenBank Nucleotide #: NM_005805
• UniProt Accession #: O00487
• Molecular Weight: 35kDa
• NCBI Official Full Name: 26S proteasome non-ATPase regulatory subunit 14
• NCBI Official Synonym Full Names: proteasome 26S subunit, non-ATPase 14
• NCBI Official Symbol: PSMD14
• NCBI Official Synonym Symbols: PAD1; POH1; RPN11
• NCBI Protein Information: 26S proteasome non-ATPase regulatory subunit 14
• UniProt Protein Name: 26S proteasome non-ATPase regulatory subunit 14
• UniProt Gene Name: PSMD14
• UniProt Synonym Gene Names: POH1
• UniProt Entry Name: PSDE_HUMAN

NCBI Description

This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. [provided by RefSeq, Feb 2012]

Uniprot Description

PSMD14: a component of the 26S proteasome. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.

Protein type: EC 3.4.19.-; Proteasome complex; Protease

Chromosomal Location of Human Ortholog: 2q24.2

Cellular Component: proteasome complex; nucleoplasm; cytosol; nucleus

Molecular Function: metallopeptidase activity; metal ion binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; double-strand break repair via nonhomologous end joining; double-strand break repair via homologous recombination; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; G1/S transition of mitotic cell cycle; negative regulation of apoptosis