Western Blot (WB)
(Host: RabbitTarget Name: ZBTB48Sample Type: 293TAntibody Dilution: 1.0ug/mlZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit ZBTB48 Polyclonal Antibody | anti-ZBTB48 antibody
ZBTB48 antibody - N-terminal region
Gene Names
ZBTB48; HKR3; TZAP; ZNF855; pp9964
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZBTB48; Polyclonal Antibody; ZBTB48 antibody - N-terminal region; anti-ZBTB48 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF
Sequence Length
688
Applicable Applications for anti-ZBTB48 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB48
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZBTB48Sample Type: 293TAntibody Dilution: 1.0ug/mlZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(Host: RabbitTarget Name: ZBTB48Sample Type: 293TAntibody Dilution: 1.0ug/mlZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-ZBTB48 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-ZBTB48 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-ZBTB48 antibody
This is a rabbit polyclonal antibody against ZBTB48. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.
Target Description: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.
Product Categories/Family for anti-ZBTB48 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
telomere zinc finger-associated protein
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 48
NCBI Official Symbol
ZBTB48
NCBI Official Synonym Symbols
HKR3; TZAP; ZNF855; pp9964
NCBI Protein Information
telomere zinc finger-associated protein
UniProt Protein Name
Zinc finger and BTB domain-containing protein 48
Protein Family
UniProt Gene Name
ZBTB48
UniProt Synonym Gene Names
HKR3; ZNF855
UniProt Entry Name
ZBT48_HUMAN
Uniprot Description
ZBTB48: Binds to and regulates the J and/or S elements in MHC II promoter. Belongs to the krueppel C2H2-type zinc-finger protein family.
Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor
Chromosomal Location of Human Ortholog: 1p36.3
Cellular Component: nucleoplasm; cytoplasm
Molecular Function: DNA binding; metal ion binding; transcription factor activity
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on ZBTB48
Similar Products
Product Notes
The ZBTB48 zbtb48 (Catalog #AAA3200655) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBTB48 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB48 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZBTB48 zbtb48 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDGSFVQHSV RVLQELNKQR EKGQYCDATL DVGGLVFKAH WSVLACCSHF. It is sometimes possible for the material contained within the vial of "ZBTB48, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
