Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TAF10Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit TAF10 Polyclonal Antibody | anti-TAF10 antibody

TAF10 antibody - middle region

Gene Names
TAF10; TAF2A; TAF2H; TAFII30
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAF10; Polyclonal Antibody; TAF10 antibody - middle region; anti-TAF10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK
Sequence Length
218
Applicable Applications for anti-TAF10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAF10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TAF10Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TAF10Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-TAF10 antibody
This is a rabbit polyclonal antibody against TAF10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF10 is one of the small subunits of TFIID th

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 10
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 10
NCBI Official Symbol
TAF10
NCBI Official Synonym Symbols
TAF2A; TAF2H; TAFII30
NCBI Protein Information
transcription initiation factor TFIID subunit 10
UniProt Protein Name
Transcription initiation factor TFIID subunit 10
UniProt Gene Name
TAF10
UniProt Synonym Gene Names
TAF2A; TAF2H; TAFII30; TAF(II)30; TAFII-30; TAFII30
UniProt Entry Name
TAF10_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF10: TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Belongs to the TAF10 family.

Protein type: Nuclear receptor co-regulator; Transcription initiation complex

Chromosomal Location of Human Ortholog: 11p15.3

Cellular Component: nucleoplasm; PCAF complex; transcription factor TFIID complex; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding; histone acetyltransferase activity; enzyme binding; transcription coactivator activity; estrogen receptor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; viral reproduction; regulation of transcription, DNA-dependent; transcription initiation; RNA elongation from RNA polymerase II promoter; gene expression; protein homooligomerization; histone deubiquitination

Research Articles on TAF10

Similar Products

Product Notes

The TAF10 taf10 (Catalog #AAA3200426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TAF10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAF10 taf10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFEASDPRII RLISLAAQKF ISDIANDALQ HCKMKGTASG SSRSKSKDRK. It is sometimes possible for the material contained within the vial of "TAF10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.