Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GABRR1Sample Tissue: Human A172 Whole CellAntibody Dilution: 1ug/ml)

Rabbit GABRR1 Polyclonal Antibody | anti-GABRR1 antibody

GABRR1 antibody - N-terminal region

Reactivity
Guinea Pig, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GABRR1; Polyclonal Antibody; GABRR1 antibody - N-terminal region; anti-GABRR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH
Sequence Length
473
Applicable Applications for anti-GABRR1 antibody
Western Blot (WB)
Homology
Guinea Pig: 87%; Human: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GABRR1Sample Tissue: Human A172 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GABRR1Sample Tissue: Human A172 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-GABRR1 antibody
This is a rabbit polyclonal antibody against GABRR1. It was validated on Western Blot

Target Description: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family.
Product Categories/Family for anti-GABRR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit rho-1 isoform a
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor rho1 subunit
NCBI Official Symbol
GABRR1
NCBI Protein Information
gamma-aminobutyric acid receptor subunit rho-1
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit rho-1
UniProt Gene Name
GABRR1
UniProt Entry Name
GBRR1_HUMAN

NCBI Description

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

GABRR1: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-1 GABA receptor could play a role in retinal neurotransmission. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRR1 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Transporter; Transporter, ion channel; Channel, ligand-gated; Membrane protein, multi-pass; Channel, chloride; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q15

Cellular Component: postsynaptic membrane; integral to plasma membrane; plasma membrane; cell junction

Molecular Function: chloride channel activity; GABA-A receptor activity; extracellular ligand-gated ion channel activity

Biological Process: synaptic transmission; transport; transmembrane transport; gamma-aminobutyric acid signaling pathway

Research Articles on GABRR1

Similar Products

Product Notes

The GABRR1 gabrr1 (Catalog #AAA3200282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRR1 antibody - N-terminal region reacts with Guinea Pig, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GABRR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABRR1 gabrr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLAVPNMRFG IFLLWWGWVL ATESRMHWPG REVHEMSKKG RPQRQRREVH. It is sometimes possible for the material contained within the vial of "GABRR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.