Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CD369 recombinant protein

CD369 Recombinant Protein

Gene Names
CLEC7A; BGR; CANDF4; DECTIN1; CLECSF12
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Synonyms
CD369; CD369 Recombinant Protein; CD369 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Sequence
TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Restriction Site
NdeI-XhoI
Expression Vector
pet-22b(+)
Preparation and Storage
Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Testing Data
Related Product Information for CD369 recombinant protein
Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of gammadelta T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for beta-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes beta-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,627 Da
NCBI Official Full Name
C-type lectin domain family 7 member A isoform b
NCBI Official Synonym Full Names
C-type lectin domain family 7, member A
NCBI Official Symbol
CLEC7A
NCBI Official Synonym Symbols
BGR; CANDF4; DECTIN1; CLECSF12
NCBI Protein Information
C-type lectin domain family 7 member A; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-typ
UniProt Protein Name
C-type lectin domain family 7 member A
UniProt Gene Name
CLEC7A
UniProt Synonym Gene Names
BGR; CLECSF12; DECTIN1; DC-associated C-type lectin 1; Dectin-1
UniProt Entry Name
CLC7A_HUMAN

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]

Uniprot Description

dectin-1: Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation. Up-regulated during differentiation from monocytes into dendritic cells. Isoform 5 interacts with RANBP9. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: cytoplasm; plasma membrane; integral to membrane

Molecular Function: metal ion binding; carbohydrate binding; MHC protein binding; pattern recognition receptor activity

Biological Process: T cell activation; innate immune response; carbohydrate mediated signaling; phagocytosis, recognition; cell recognition; pattern recognition receptor signaling pathway; defense response to protozoan; inflammatory response

Disease: Candidiasis, Familial, 4; Aspergillosis, Susceptibility To

Research Articles on CD369

Similar Products

Product Notes

The CD369 clec7a (Catalog #AAA3016000) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TMAIWRSNSG SNTLENGYFL SRNKENHSQP TQSSLEDSVT PTKAVKTTGV LSSPCPPNWI IYEKSCYLFS MSLNSWDGSK RQCWQLGSNL LKIDSSNELG FIVKQVSSQP DNSFWIGLSR PQTEVPWLWE DGSTFSSNLF QIRTTATQEN PSPNCVWIHV SVIYDQLCSV PSYSICEKKF SM. It is sometimes possible for the material contained within the vial of "CD369, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.