Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD361 recombinant protein

CD361 Recombinant Protein

Gene Names
EVI2B; EVDB; CD361; D17S376
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD361; CD361 Recombinant Protein; CD361 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
555
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD361 recombinant protein
Background: EVI2B, required for granulocyte differentiation and functionality of hematopoietic progenitor cells through the control of cell cycle progression and survival of hematopoietic progenitor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,666 Da
NCBI Official Full Name
protein EVI2B
NCBI Official Synonym Full Names
ecotropic viral integration site 2B
NCBI Official Symbol
EVI2B
NCBI Official Synonym Symbols
EVDB; CD361; D17S376
NCBI Protein Information
protein EVI2B; EVI-2B; ecotropic viral integration site 2B protein homolog
UniProt Protein Name
Protein EVI2B
UniProt Gene Name
EVI2B
UniProt Synonym Gene Names
EVDB; EVI-2B
UniProt Entry Name
EVI2B_HUMAN

Similar Products

Product Notes

The CD361 evi2b (Catalog #AAA3004377) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KTETITTEKQ SQPTLFTSSM SQVLANSQNT TGNPLGQPTQ FSDTFSGQSI SPAKVTAGQP TPAVYTSSEK PEAHTSAGQP LAYNTKQPTP IANTSSQQAV FTSARQLPSA RTSTTQPPKS FVYTFTQQSS SVQIPSRKQI TVHNPSTQPT STVKNSPRST PGFILDTTSN KQTPQKNNYN S. It is sometimes possible for the material contained within the vial of "CD361, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.