Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD1D recombinant protein

CD1D Recombinant Protein

Gene Names
CD1D; R3; CD1A
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD1D; CD1D Recombinant Protein; CD1D recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
858
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD1D recombinant protein
Background: The CD1 multigene family encodes five forms of the CD1 T cell surface glycoprotein in human, designated CD1A, 1B, 1C, 1D and 1E. CD1, a type 1 membrane protein, has structural similarity to the MHC class I antigen and has been shown to present lipid antigens for recognition by T lymphocytes. CD1 antigens are associated with beta-2-Microglobulin and expressed on cortical thymocytes, Langerhans cells, a B cell subset and some dendritic cells. Adaptor protein complexes and CD1-associated chaperones control CD1 trafficking and the development and activation of CD1-restricted T cells. CD1D is present on human intestinal epithelial cells (IEC) and exists as a beta-2-Microglobulinindependent nonglycosylated form or a beta-2-Microglobulin-dependent glycosylated form. The human CD1D gene maps to chromosome 1q23.1 and encodes a 335 amino acid protein that influences normal T cell maturation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
912
UniProt Accession #
Molecular Weight
335
NCBI Official Full Name
Antigen-presenting glycoprotein CD1d
NCBI Official Synonym Full Names
CD1d molecule
NCBI Official Symbol
CD1D
NCBI Official Synonym Symbols
R3; CD1A
NCBI Protein Information
antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D
UniProt Protein Name
Antigen-presenting glycoprotein CD1d
UniProt Gene Name
CD1D
UniProt Entry Name
CD1D_HUMAN

NCBI Description

This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

CD1D: Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

Protein type: Apoptosis; Membrane protein, integral; Lipid-binding; Cell surface

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: cell surface; lysosomal membrane; integral to plasma membrane; cytoplasm; endosome membrane

Molecular Function: histone binding; beta-2-microglobulin binding; exogenous lipid antigen binding; lipid antigen binding; cell adhesion molecule binding; receptor activity; endogenous lipid antigen binding

Biological Process: antigen processing and presentation, endogenous lipid antigen via MHC class Ib; heterotypic cell-cell adhesion; detection of bacterium; viral reproduction; positive regulation of innate immune response; antigen processing and presentation, exogenous lipid antigen via MHC class Ib; T cell selection; innate immune response; positive regulation of T cell proliferation

Research Articles on CD1D

Similar Products

Product Notes

The CD1D cd1d (Catalog #AAA3003523) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EVPQRLFPLR CLQISSFANS SWTRTDGLAW LGELQTHSWS NDSDTVRSLK PWSQGTFSDQ QWETLQHIFR VYRSSFTRDV KEFAKMLRLS YPLELQVSAG CEVHPGNASN NFFHVAFQGK DILSFQGTSW EPTQEAPLWV NLAIQVLNQD KWTRETVQWL LNGTCPQFVS GLLESGKSEL KKQVKPKAWL SRGPSPGPGR LLLVCHVSGF YPKPVWVKWM RGEQEQQGTQ PGDILPNADE TWYLRATLDV VAGEAAGLSC RVKHSSLEGQ DIVLYWGGSY TS. It is sometimes possible for the material contained within the vial of "CD1D, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.