TLN1 recombinant protein

Recombinant Human TLN1 Protein

Cat. Num. AAA286225

• Gene Names: TLN1; TLN; ILWEQ
• Applications: Western Blot, ELISA, SDS-Page
• Purity: > 90% as determined by SDS-PAGE
• Synonyms: TLN1; Recombinant Human TLN1 Protein; ILWEQ; TLN; TLN1 recombinant protein

• Host: E Coli
• Purity/Purification: > 90% as determined by SDS-PAGE
• Form/Format: 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, with 10% glycerol.
• Concentration: 0.2 mg/mL (varies by lot)
• Sequence: MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLR KDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFF YSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPH NEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLAR SLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIK RWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
• Sequence Length: 2541

• Applicable Applications for TLN1 recombinant protein: Western Blot (WB), ELISA (EIA), SDS-PAGE, Antigen
• Source: Human
• Protein residues: with N-terminal GST-tagged.
• Predicted MW: 62.8 kDa
• Observed MW: 63 kDa
• ENDOTOXIN LEVEL: Please contact us for more information.
• USAGE: TLN1 Protein-Centrifuge the standard vial at 6000-10000rpm for 30s.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.; ; The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

Related Product Information for TLN1 recombinant protein

TLN1 is a high-molecular-weight cytoskeletal protein concentrated at regions of cell-substratum contactand, in lymphocytes, at cell-cell contacts. Talin-1 is a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. Thi s protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

NCBI and Uniprot Product Information

• NCBI GI #: 223029410
• NCBI GeneID: 7094
• NCBI Accession #: NP_006280.3
• NCBI GenBank Nucleotide #: NM_006289.3
• UniProt Accession #: Q9Y490; Q86YD0; Q9NZQ2; Q9UHH8; Q9UPX3; A6NMY0
• Molecular Weight: 28kDa
• NCBI Official Full Name: talin-1
• NCBI Official Synonym Full Names: talin 1
• NCBI Official Symbol: TLN1
• NCBI Official Synonym Symbols: TLN; ILWEQ
• NCBI Protein Information: talin-1
• UniProt Protein Name: Talin-1
• Protein Family: Talin
• UniProt Gene Name: TLN1
• UniProt Synonym Gene Names: KIAA1027; TLN
• UniProt Entry Name: TLN1_HUMAN

NCBI Description

This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin. [provided by RefSeq, Feb 2009]

Uniprot Description

Talin-1: a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. This protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: cell-cell adherens junction; cytoplasm; cytosol; extracellular region; focal adhesion; intercellular junction; microtubule organizing center; plasma membrane; ruffle

Molecular Function: integrin binding; LIM domain binding; protein binding; vinculin binding

Biological Process: intercellular junction assembly; muscle contraction; platelet degranulation