TNNC1 recombinant protein

Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1) Protein

Cat. Num. AAA286212

• Gene Names: TNNC1; TNC; TN-C; TNNC; CMD1Z; CMH13
• Reactivity: Human
• Purity: > 90% as determined by SDS-PAGE
• Synonyms: TNNC1; Recombinant Human Troponin C; slow skeletal and cardiac muscles (TNNC1) Protein; TNC; TroponinC; Cardiac; Troponin C Type 1; Slow.; TNNC1 recombinant protein

• Host: E. Coli AA 1-161
• Reactivity: Human
• Purity/Purification: > 90% as determined by SDS-PAGE
• Form/Format: Lyophilized powder; 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCI, 300 mM Imidazole, pH 8.0, Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
• Sequence Length: 1-161

• Protein Residues: With N-Terminal 6*His-tag.
• Source: Human
• Usage: TNNC1 Protein - We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glyerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receiving. Recommended to aliquot the protein into smaller quantities for optimal storage.; **Avoid repeated freeze-thaw cycles.**; ; The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

SDS-PAGE

Related Product Information for TNNC1 recombinant protein

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: Tnl, which is inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of Tnl, thus allowing the interaction of actin with myosin, the hydrolysis at ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. using a human/rodent monochromosomal mapping panel, Song et al. (1996) mapped a human symbolized TNNC1 to chromosome 3 by PCR. Chromosome 3 somatic cell hybrids with various rearrangements were used for finer mapping to 3p21.3-p14.3.

NCBI and Uniprot Product Information

• NCBI GI #: 4507615
• NCBI GeneID: 7134
• NCBI Accession #: NP_003271.1
• NCBI GenBank Nucleotide #: NM_003280.2
• UniProt Accession #: P63316; O14800; P02590; P04463
• Molecular Weight: Predicted MW: 20 kDa; Calculated MW: 20 kDa
• NCBI Official Full Name: troponin C, slow skeletal and cardiac muscles
• NCBI Official Synonym Full Names: troponin C1, slow skeletal and cardiac type
• NCBI Official Symbol: TNNC1
• NCBI Official Synonym Symbols: TNC; TN-C; TNNC; CMD1Z; CMH13
• NCBI Protein Information: troponin C, slow skeletal and cardiac muscles
• UniProt Protein Name: Troponin C, slow skeletal and cardiac muscles
• Protein Family: Troponin
• UniProt Gene Name: TNNC1
• UniProt Synonym Gene Names: TNNC; TN-C
• UniProt Entry Name: TNNC1_HUMAN

NCBI Description

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008]

Uniprot Description

TNNC1: Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments. Defects in TNNC1 are the cause of cardiomyopathy dilated type 1Z (CMD1Z). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Defects in TNNC1 are the cause of familial hypertrophic cardiomyopathy type 13 (CMH13). A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. Belongs to the troponin C family.

Protein type: Calcium-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: actin cytoskeleton; cytosol; mitochondrion; nucleoplasm; troponin complex

Molecular Function: actin filament binding; calcium ion binding; calcium-dependent protein binding; protein binding; protein homodimerization activity; troponin I binding; troponin T binding

Biological Process: cardiac muscle contraction; muscle filament sliding; regulation of ATPase activity; regulation of muscle contraction; regulation of muscle filament sliding speed; skeletal muscle contraction; ventricular cardiac muscle morphogenesis

Disease: Cardiomyopathy, Dilated, 1z; Cardiomyopathy, Familial Hypertrophic, 13