Interleukin 2 Recombinant Protein | IL2Ra recombinant protein
Recombinant Interleukin 2 Receptor Alpha (IL2Ra)
Source: Prokaryotic expression
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LCLYDPPE VPNATFKALS YKNGTILNCE CKRGFRRLNE LVYMACLGNS WSNNCQCTSN SHDNSREQVT PQPEGQKEQQ TTDTQKSTQS VYQENLAGHC REPPPWRHED TKRIYHFVEG QIVLYTCIQG YKALQRGPAI SICKTVCGEI RWTHPQLTCV DEKEHHQFLA SEESQGSRNS FPESEASCPT PNTDFSQLTE ATTTMETFVF TKEYQ
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. The loss of this protein is less than 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also shared by interleukin 4 (IL4) and interleukin 7 (IL7). The expression of this gene in mature thymocytes is monoallelic, which represents an unusual regulatory mode for controlling the precise expression of a single gene. The targeted disruption of a similar gene in mice leads to ulcerative colitis-like disease, which suggests an essential role of this gene in the immune response to antigenic stimuli. [provided by RefSeq, Jul 2008]
Uniprot Description
IL2: Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells. A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. Belongs to the IL-2 family.
Protein type: Oncoprotein; Secreted, signal peptide; Secreted; Cytokine
Chromosomal Location of Human Ortholog: 4q26-q27
Cellular Component: extracellular space; extracellular region
Molecular Function: growth factor activity; interleukin-2 receptor binding; cytokine activity; kinase activator activity; carbohydrate binding; glycosphingolipid binding; kappa-type opioid receptor binding
Biological Process: positive regulation of isotype switching to IgG isotypes; negative regulation of heart contraction; natural killer cell activation; positive regulation of activated T cell proliferation; negative regulation of lymphocyte proliferation; elevation of cytosolic calcium ion concentration; cell-cell signaling; negative regulation of protein amino acid phosphorylation; protein kinase C activation; positive regulation of cell proliferation; positive regulation of B cell proliferation; cell adhesion; T cell differentiation; positive regulation of interleukin-17 production; regulation of T cell homeostatic proliferation; positive regulation of regulatory T cell differentiation; positive regulation of immunoglobulin secretion; positive regulation of cell growth; positive regulation of tissue remodeling; positive regulation of interferon-gamma production; positive regulation of tyrosine phosphorylation of Stat5 protein; negative regulation of inflammatory response; immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of B cell apoptosis; negative regulation of apoptosis; positive regulation of inflammatory response
Research Articles on IL2Ra
Similar Products
Product Notes
The IL2Ra il2 (Catalog #AAA2029862) is a Recombinant Protein produced from Host: E Coli Source: Prokaryotic expression and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Interleukin 2 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the IL2Ra il2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.MHHHHHHSS GLVPRGSGMK ETAAAKFERQ HMDSPDLGTD DDDKAMADIG SEF-LCLYDP PE VPNATFKALS YKNGTILNCE CKRGFRRLNE LVYMACLGNS WSNNCQCTSN SHDNSREQVT PQPEGQKEQQ TTDTQKSTQS VYQENLAGHC REPPPWRHED TKRIYHFVEG QIVLYTCIQG YKALQRGPAI SICKTVCGEI RWTHPQLTCV DEKEHHQFLA SEESQGSRNS FPESEASCPT PNTDFSQLTE ATTTMETFVF TKEYQ
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.