<
WB (Western Blot)
(WB Suggested Anti-CUL4A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Rabbit CUL4A Polyclonal Antibody | anti-CUL4A antibody
CUL4A antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CUL4A, Antibody; CUL4A antibody - middle region; anti-CUL4A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVE
Sequence Length
759
Applicable Applications for anti-CUL4A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CUL4A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
WB (Western Blot)
(WB Suggested Anti-CUL4A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
WB (Western Blot)
(Host: RabbitTarget Name: CUL4ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CUL4ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CUL4ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CUL4ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-CUL4A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-CUL4A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CUL4A antibody
This is a rabbit polyclonal antibody against CUL4A. It was validated on Western Blot
Target Description: CUL4A is the ubiquitin ligase component of a multimeric complex involved in the degradation of DNA damage-response proteins.
Target Description: CUL4A is the ubiquitin ligase component of a multimeric complex involved in the degradation of DNA damage-response proteins.
Product Categories/Family for anti-CUL4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
cullin-4A isoform 1
NCBI Official Synonym Full Names
cullin 4A
NCBI Official Symbol
CUL4A
NCBI Protein Information
cullin-4A
UniProt Protein Name
Cullin-4A
UniProt Gene Name
CUL4A
UniProt Synonym Gene Names
CUL-4A
UniProt Entry Name
CUL4A_HUMAN
Similar Products
Product Notes
The CUL4A cul4a (Catalog #AAA201107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUL4A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CUL4A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CUL4A cul4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLACGKARVL IKSPKGKEVE DGDKFIFNGE FKHKLFRIKI NQIQMKETVE. It is sometimes possible for the material contained within the vial of "CUL4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.