Caspase 8 (CASP8) Recombinant Protein | CASP8 recombinant protein

Recombinant Caspase 8 (CASP8)

Cat. Num. AAA2010714

• Gene Names: Casp8; MACH; Mch5; FLICE; CASP-8
• Applications: SDS-Page, Western Blot, ELISA, Immunoprecipitation
• Purity: > 95%
• Synonyms: Caspase 8 (CASP8); Recombinant Caspase 8 (CASP8); CASP8 recombinant protein

• Host: E Coli
• Purity/Purification: > 95%
• Form/Format: Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
• Sequence: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.; MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SE SRTSDKVYQM KNKPRGYCLI INNHDFSKAR EDITQLRKMK DRKGTDCDKE ALSKTFKELH FEIVSYDDCT ANEIHEILEG YQSADHKNKD CFICCILSHG DKGVVYGTDG KEASIYDLTS YFTGSKCPSL SGKPKIFFIQ ACQGSNFQKG VPDEAG
• Sequence Length: 480

• Applicable Applications for CASP8 recombinant protein: SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
• Organism: Mus musculus (Mouse)
• Expression System: Prokaryotic expression
• Residues: Ser219~Gly376 (Accession # O89110) with two N-terminal Tags, His-tag and T7-tag
• Endotoxin Level: <1.0EU per 1ug (determined by the LAL method)
• Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.
• Preparation and Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.; Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

• NCBI GI #: 122056578
• NCBI GeneID: 12370
• NCBI Accession #: NP_001073595.1
• NCBI GenBank Nucleotide #: NM_001080126.1
• UniProt Accession #: O89110; O35669
• Molecular Weight: 21.6kDa
• NCBI Official Full Name: caspase-8 isoform 1
• NCBI Official Synonym Full Names: caspase 8
• NCBI Official Symbol: Casp8
• NCBI Official Synonym Symbols: MACH; Mch5; FLICE; CASP-8
• NCBI Protein Information: caspase-8; Fas-linked ICE-like protease
• UniProt Protein Name: Caspase-8
• Protein Family: Caspase
• UniProt Gene Name: Casp8
• UniProt Synonym Gene Names: CASP-8
• UniProt Entry Name: CASP8_MOUSE

NCBI Description

This gene is part of a family of caspases, aspartate-specific cysteine proteases well studied for their involvement in immune and apoptosis signaling. This protein, an initiator of apoptotic cell death, is activated by death-inducing tumor necrosis family receptors and targets downstream effectors. In mouse deficiency of this gene can cause embryonic lethality. This protein may have a role in embryogenesis. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Apr 2013]

Uniprot Description

CASP8: Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death- inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9 interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2. Interacts with human cytomegalovirus/HHV-5 protein vICA/UL36; this interaction inhibits CASP8 activation. Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle. Belongs to the peptidase C14A family. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Protease; EC 3.4.22.61

Cellular Component: nucleoplasm; neuron projection; protein complex; mitochondrion; Noc1p-Noc2p complex; cytoplasm; CD95 death-inducing signaling complex; microtubule organizing center; nucleus; cytosol; lipid raft

Molecular Function: peptidase activity; protein binding; hydrolase activity; protein heterodimerization activity; ubiquitin protein ligase binding; cysteine-type endopeptidase activity; endopeptidase activity; death receptor binding; protein complex binding; tumor necrosis factor receptor binding; cysteine-type peptidase activity

Biological Process: cardiac muscle development; caspase activation; macrophage differentiation; positive regulation of I-kappaB kinase/NF-kappaB cascade; apoptosis; protein heterooligomerization; positive regulation of proteolysis; heart development; negative regulation of I-kappaB kinase/NF-kappaB cascade; proteolysis; regulation of apoptosis; response to ethanol; induction of apoptosis via death domain receptors; proteolysis involved in cellular protein catabolic process; angiogenesis; neural tube formation; positive regulation of macrophage differentiation