Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (DAB staining on IHC-P. Samples: Mouse Tissue)

Rabbit anti-Mouse Caspase 8 (CASP8) Polyclonal Antibody | anti-CASP8 antibody

Polyclonal Antibody to Caspase 8 (CASP8)

Gene Names
Casp8; MACH; Mch5; FLICE; CASP-8
Reactivity
Mouse
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Caspase 8 (CASP8); Polyclonal Antibody; Polyclonal Antibody to Caspase 8 (CASP8); anti-CASP8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against CASP8. It has been selected for its ability to recognize CASP8 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
0.62mg/ml (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SE SRTSDKVYQM KNKPRGYCLI INNHDFSKAR EDITQLRKMK DRKGTDCDKE ALSKTFKELH FEIVSYDDCT ANEIHEILEG YQSADHKNKD CFICCILSHG DKGVVYGTDG KEASIYDLTS YFTGSKCPSL SGKPKIFFIQ ACQGSNFQKG VPDEAG
Sequence Length
479
Applicable Applications for anti-CASP8 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant CASP8 (Ser219~Gly376) expressed in E.coli.
Cross Reactivity
Mouse
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2048685
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Immunohistochemistry (IHC)

(DAB staining on IHC-P. Samples: Mouse Tissue)

Immunohistochemistry (IHC) (DAB staining on IHC-P. Samples: Mouse Tissue)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,357 Da
NCBI Official Full Name
caspase-8 isoform 1
NCBI Official Synonym Full Names
caspase 8
NCBI Official Symbol
Casp8
NCBI Official Synonym Symbols
MACH; Mch5; FLICE; CASP-8
NCBI Protein Information
caspase-8
UniProt Protein Name
Caspase-8
Protein Family
UniProt Gene Name
Casp8
UniProt Synonym Gene Names
CASP-8

NCBI Description

This gene is part of a family of caspases, aspartate-specific cysteine proteases well studied for their involvement in immune and apoptosis signaling. This protein, an initiator of apoptotic cell death, is activated by death-inducing tumor necrosis family receptors and targets downstream effectors. In mouse deficiency of this gene can cause embryonic lethality. This protein may have a role in embryogenesis. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Apr 2013]

Uniprot Description

CASP8: Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death- inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9 interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2. Interacts with human cytomegalovirus/HHV-5 protein vICA/UL36; this interaction inhibits CASP8 activation. Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle. Belongs to the peptidase C14A family. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.4.22.61; Protease

Chromosomal Location of Human Ortholog: 1 C1.3|1 29.19 cM

Cellular Component: CD95 death-inducing signaling complex; cell body; cytoplasm; cytosol; membrane raft; mitochondrion; neuron projection; Noc1p-Noc2p complex; nucleoplasm; nucleus; plasma membrane; protein complex

Molecular Function: cysteine-type endopeptidase activity; cysteine-type peptidase activity; death receptor binding; endopeptidase activity; hydrolase activity; identical protein binding; peptidase activity; protein binding; protein complex binding; protein heterodimerization activity; tumor necrosis factor receptor binding; ubiquitin protein ligase binding

Biological Process: activation of cysteine-type endopeptidase activity involved in apoptotic process; angiogenesis; apoptosis; cardiac muscle tissue development; heart development; induction of apoptosis via death domain receptors; macrophage differentiation; negative regulation of I-kappaB kinase/NF-kappaB signaling; neural tube formation; positive regulation of apoptosis; positive regulation of extrinsic apoptotic signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB signaling; positive regulation of macrophage differentiation; positive regulation of neuron death; positive regulation of proteolysis; proteolysis; proteolysis involved in cellular protein catabolic process; regulation of apoptosis; regulation of apoptotic signaling pathway; response to ethanol; response to tumor necrosis factor; TRAIL-activated apoptotic signaling pathway

Research Articles on CASP8

Similar Products

Product Notes

The CASP8 casp8 (Catalog #AAA2002670) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Caspase 8 (CASP8) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase 8 (CASP8) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the CASP8 casp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-SE SRTSDKVYQM KNKPRGYCLI INNHDFSKAR EDITQLRKMK DRKGTDCDKE ALSKTFKELH FEIVSYDDCT ANEIHEILEG YQSADHKNKD CFICCILSHG DKGVVYGTDG KEASIYDLTS YFTGSKCPSL SGKPKIFFIQ ACQGSNFQKG VPDEAG. It is sometimes possible for the material contained within the vial of "Caspase 8 (CASP8), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.