Rabbit anti-Mouse Caspase 8 (CASP8) Polyclonal Antibody | anti-CASP8 antibody
Polyclonal Antibody to Caspase 8 (CASP8)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SE SRTSDKVYQM KNKPRGYCLI INNHDFSKAR EDITQLRKMK DRKGTDCDKE ALSKTFKELH FEIVSYDDCT ANEIHEILEG YQSADHKNKD CFICCILSHG DKGVVYGTDG KEASIYDLTS YFTGSKCPSL SGKPKIFFIQ ACQGSNFQKG VPDEAG
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
NCBI and Uniprot Product Information
NCBI Description
This gene is part of a family of caspases, aspartate-specific cysteine proteases well studied for their involvement in immune and apoptosis signaling. This protein, an initiator of apoptotic cell death, is activated by death-inducing tumor necrosis family receptors and targets downstream effectors. In mouse deficiency of this gene can cause embryonic lethality. This protein may have a role in embryogenesis. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Apr 2013]
Uniprot Description
CASP8: Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death- inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9 interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2. Interacts with human cytomegalovirus/HHV-5 protein vICA/UL36; this interaction inhibits CASP8 activation. Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle. Belongs to the peptidase C14A family. 9 isoforms of the human protein are produced by alternative splicing.
Protein type: Apoptosis; EC 3.4.22.61; Protease
Chromosomal Location of Human Ortholog: 1 C1.3|1 29.19 cM
Cellular Component: CD95 death-inducing signaling complex; cell body; cytoplasm; cytosol; membrane raft; mitochondrion; neuron projection; Noc1p-Noc2p complex; nucleoplasm; nucleus; plasma membrane; protein complex
Molecular Function: cysteine-type endopeptidase activity; cysteine-type peptidase activity; death receptor binding; endopeptidase activity; hydrolase activity; identical protein binding; peptidase activity; protein binding; protein complex binding; protein heterodimerization activity; tumor necrosis factor receptor binding; ubiquitin protein ligase binding
Biological Process: activation of cysteine-type endopeptidase activity involved in apoptotic process; angiogenesis; apoptosis; cardiac muscle tissue development; heart development; induction of apoptosis via death domain receptors; macrophage differentiation; negative regulation of I-kappaB kinase/NF-kappaB signaling; neural tube formation; positive regulation of apoptosis; positive regulation of extrinsic apoptotic signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB signaling; positive regulation of macrophage differentiation; positive regulation of neuron death; positive regulation of proteolysis; proteolysis; proteolysis involved in cellular protein catabolic process; regulation of apoptosis; regulation of apoptotic signaling pathway; response to ethanol; response to tumor necrosis factor; TRAIL-activated apoptotic signaling pathway
Research Articles on CASP8
Similar Products
Product Notes
The CASP8 casp8 (Catalog #AAA2002670) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Caspase 8 (CASP8) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase 8 (CASP8) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the CASP8 casp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-SE SRTSDKVYQM KNKPRGYCLI INNHDFSKAR EDITQLRKMK DRKGTDCDKE ALSKTFKELH FEIVSYDDCT ANEIHEILEG YQSADHKNKD CFICCILSHG DKGVVYGTDG KEASIYDLTS YFTGSKCPSL SGKPKIFFIQ ACQGSNFQKG VPDEAG. It is sometimes possible for the material contained within the vial of "Caspase 8 (CASP8), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.