Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Macrophage Inflammatory Protein 4 Alpha (MIP4a) Recombinant Protein | MIP4a recombinant protein

Recombinant Macrophage Inflammatory Protein 4 Alpha (MIP4a)

Gene Names
CCL26; IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Macrophage Inflammatory Protein 4 Alpha (MIP4a); Recombinant Macrophage Inflammatory Protein 4 Alpha (MIP4a); MIP4a recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-TRGSDIS KTCCFQYSHK PLPWTWVRSY EFTSNSCSQR AVIFTTKRGK KVCTHPRKKW VQKYISLLKT PKQL
Sequence Length
94
Applicable Applications for MIP4a recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Thr24~Leu94 (Accession # Q9Y258) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.8kDa
NCBI Official Full Name
C-C motif chemokine 26
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 26
NCBI Official Symbol
CCL26
NCBI Official Synonym Symbols
IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
NCBI Protein Information
C-C motif chemokine 26; eotaxin-3; MIP-4-alpha; chemokine N1; CC chemokine IMAC; thymic stroma chemokine-1; small inducible cytokine A26; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26
UniProt Protein Name
C-C motif chemokine 26
UniProt Gene Name
CCL26
UniProt Synonym Gene Names
SCYA26; MIP-4-alpha; TSC-1
UniProt Entry Name
CCL26_HUMAN

NCBI Description

This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL26: Chemotactic for eosinophils and basophils. Binds to CCR3. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; Chemokine

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: extracellular space

Molecular Function: chemokine activity

Biological Process: cell-cell signaling; positive regulation of actin filament polymerization; immune response; positive regulation of endothelial cell proliferation; signal transduction; chemotaxis; inflammatory response; positive regulation of cell migration

Research Articles on MIP4a

Similar Products

Product Notes

The MIP4a ccl26 (Catalog #AAA2010625) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Macrophage Inflammatory Protein 4 Alpha (MIP4a) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the MIP4a ccl26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS -TRGSDIS KTCCFQYSHK PLPWTWVRSY EFTSNSCSQR AVIFTTKRGK KVCTHPRKKW VQKYISLLKT PKQL. It is sometimes possible for the material contained within the vial of "Macrophage Inflammatory Protein 4 Alpha (MIP4a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.