UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGGT2) Recombinant Protein | UGGT2 recombinant protein
Recombinant UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGGT2)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-HKENKKEKDV LNIFSVASGH LYERFLRIMM LSVLRNTKTP VKFWLLKNYL SPTFKEVIPH MAKEYGFRYE LVQYRWPRWL RQQTERQRII WGYKILFLDV LFPLAVDKII FVDADQIVRH DLKELRDFDL DGAPYGYTPF CDSRREMDGY RFWKTGYWAS HLLRRKYHIS ALYVVDLKKF RRIGAGDR
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.[supplied by OMIM, Oct 2009]
Uniprot Description
UGCGL2: Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation. Belongs to the glycosyltransferase 8 family.
Protein type: EC 2.4.1.-; Transferase
Chromosomal Location of Human Ortholog: 13q32.1
Cellular Component: endoplasmic reticulum lumen; ER-Golgi intermediate compartment
Molecular Function: UDP-glucose:glycoprotein glucosyltransferase activity
Biological Process: cellular protein metabolic process; protein folding; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification
Research Articles on UGGT2
Similar Products
Product Notes
The UGGT2 uggt2 (Catalog #AAA2009071) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGGT2) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the UGGT2 uggt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-HKENKKE KDV LNIFSVASGH LYERFLRIMM LSVLRNTKTP VKFWLLKNYL SPTFKEVIPH MAKEYGFRYE LVQYRWPRWL RQQTERQRII WGYKILFLDV LFPLAVDKII FVDADQIVRH DLKELRDFDL DGAPYGYTPF CDSRREMDGY RFWKTGYWAS HLLRRKYHIS ALYVVDLKKF RRIGAGDR. It is sometimes possible for the material contained within the vial of "UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGGT2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.