Rabbit anti-Mouse Heme Oxygenase 1, Decycling (HO1) Polyclonal Antibody | anti-HO1 antibody
Polyclonal Antibody to Heme Oxygenase 1, Decycling (HO1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PH WQEIIPCTPA TQHYVKRLHE VGRTHPELLV AHAYTRYLGD LSGGQVLKKI AQKAMALPSS GEGLAFFTFP NIDSPTKFKQ LYRARMNTLE MTPEVKHRVT EEAKTAFLLN IELFEELQVM LTEEHKDQSP SQMASLR
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Western Blot (WB)
(Western Blot: Sample: Mouse Lung lysate; Primary Ab: 1ug/ml Rabbit Anti-Mouse HO1 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )
NCBI and Uniprot Product Information
Uniprot Description
HMOX1: Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Heme oxygenase 1 activity is highly inducible by its substrate heme and by various non-heme substances such as heavy metals, bromobenzene, endotoxin, oxidizing agents and UVA. Expressed at higher levels in renal cancer tissue than in normal tissue. Belongs to the heme oxygenase family.
Protein type: Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; EC 1.14.99.3; Oxidoreductase
Chromosomal Location of Human Ortholog: 8 35.59 cM|8 C1
Cellular Component: caveola; cytosol; endoplasmic reticulum; intracellular membrane-bound organelle; membrane; nucleolus; nucleus; perinuclear region of cytoplasm
Molecular Function: enzyme binding; heme binding; heme oxygenase (decyclizing) activity; metal ion binding; oxidoreductase activity; phospholipase D activity; protein homodimerization activity; signal transducer activity
Biological Process: angiogenesis; apoptosis; cell death; cellular iron ion homeostasis; DNA damage response, signal transduction resulting in induction of apoptosis; erythrocyte homeostasis; healing during inflammatory response; heme catabolic process; heme metabolic process; heme oxidation; iron ion homeostasis; negative regulation of cell proliferation; negative regulation of DNA binding; negative regulation of macroautophagy; negative regulation of mast cell cytokine production; negative regulation of mast cell degranulation; negative regulation of neuron apoptosis; negative regulation of smooth muscle cell proliferation; negative regulation of transcription factor activity; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of I-kappaB kinase/NF-kappaB signaling; positive regulation of macroautophagy; positive regulation of smooth muscle cell proliferation; protein homooligomerization; regulation of blood pressure; regulation of transcription factor activity; regulation of transcription from RNA polymerase II promoter in response to oxidative stress; response to estrogen; response to hydrogen peroxide; response to hypoxia; response to nicotine; response to oxidative stress; small GTPase mediated signal transduction
Research Articles on HO1
Similar Products
Product Notes
The HO1 hmox1 (Catalog #AAA2005956) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Heme Oxygenase 1, Decycling (HO1) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Heme Oxygenase 1, Decycling (HO1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the HO1 hmox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-PH WQEIIPCTPA TQHYVKRLHE VGRTHPELLV AHAYTRYLGD LSGGQVLKKI AQKAMALPSS GEGLAFFTFP NIDSPTKFKQ LYRARMNTLE MTPEVKHRVT EEAKTAFLLN IELFEELQVM LTEEHKDQSP SQMASLR. It is sometimes possible for the material contained within the vial of "Heme Oxygenase 1, Decycling (HO1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.