Rabbit anti-Sheep Tumor Necrosis Factor Alpha (TNFa) Polyclonal Antibody | anti-TNFa antibody
Polyclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-LRS SSQASNNKPV AHVVANISAP GQLRWGDSYA NALMANGVEL KDNQLVVPTD GLYLIYSQVL FRGHGCPSTP LFLTHTISRI AVSYQTKVNI LSAIKSPCHR ETLEGAEAKP WYEPIYQGGV FQLEKGDRLS AEINLPEYLD YAESGQVYFG IIAL
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
NCBI and Uniprot Product Information
Uniprot Description
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Research Articles on TNFa
Similar Products
Product Notes
The TNFa tnf (Catalog #AAA2004318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Tumor Necrosis Factor Alpha (TNFa) reacts with Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Tumor Necrosis Factor Alpha (TNFa) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the TNFa tnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-LRS SSQASNNKPV AHVVANISAP GQLRWGDSYA NALMANGVEL KDNQLVVPTD GLYLIYSQVL FRGHGCPSTP LFLTHTISRI AVSYQTKVNI LSAIKSPCHR ETLEGAEAKP WYEPIYQGGV FQLEKGDRLS AEINLPEYLD YAESGQVYFG IIAL. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Alpha (TNFa), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.