Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CCL3 (MIP-1alpha) Active Protein | CCL3 active protein

Recombinant CCL3 (MIP-1alpha), biotinylated

Gene Names
CCL3; MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
Purity
>97% by SDS-PAGE
Synonyms
CCL3 (MIP-1alpha); Recombinant CCL3 (MIP-1alpha); biotinylated; Human CCL3; CCL3 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE
Form/Format
Lyophilized
Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA
Sequence Length
92
Source
Human
Endotoxin
<0.01 EU per 1ug of protein by LAL method.
Activity
EC50 = 1.1-2.6nM determined by Migration Assay of recombinant CCR5-expressing cells.
Modification
Biotinylated
Reconstitution
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
Carrier Protein
None
Preparation and Storage
12 months from date of receipt,-20 degree C to-70 degree C, as supplied.
1 month,-20 degree C to-70 degree C, under sterile conditions after reconstitution.
Best if used immediately after reconstitution.
Avoid multiple freeze-thaw cycles.
Related Product Information for CCL3 active protein
CCL3, also known as Macrophage Inflammatory Protein-1alpha (MIP-1alpha), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIVsuppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,085 Da
NCBI Official Full Name
C-C motif chemokine 3
NCBI Official Synonym Full Names
C-C motif chemokine ligand 3
NCBI Official Symbol
CCL3
NCBI Official Synonym Symbols
MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
NCBI Protein Information
C-C motif chemokine 3
UniProt Protein Name
C-C motif chemokine 3
Protein Family
UniProt Gene Name
CCL3
UniProt Synonym Gene Names
G0S19-1; MIP1A; SCYA3; MIP-1-alpha

NCBI Description

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

Uniprot Description

Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Research Articles on CCL3

Similar Products

Product Notes

The CCL3 ccl3 (Catalog #AAA191496) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SLAADTPTAC CFSYTSRQIP QNFIADYFET SSQCSKPGVI FLTKRSRQV CADPSEEWVQ KYVSDLELSA. It is sometimes possible for the material contained within the vial of "CCL3 (MIP-1alpha), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.