Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of AP2M1 expression in rat kidney extract (lane 1), NIH3T3 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). AP2M1 at 50KD was detected using rabbit anti- AP2M1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit AP2M1 Polyclonal Antibody | anti-AP2M1 antibody

Anti-AP2M1 Antibody

Gene Names
AP2M1; mu2; AP50; CLAPM1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
AP2M1; Polyclonal Antibody; Anti-AP2M1 Antibody; Adaptin mu 1; Adaptin-mu2; AP 2 mu 2 chain; AP-2 complex subunit mu; Ap2m1; AP50; CLAPM1; Q96CW1; adaptor related protein complex 2 mu 1 subunit; anti-AP2M1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
433
Applicable Applications for anti-AP2M1 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of AP2M1 expression in rat kidney extract (lane 1), NIH3T3 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). AP2M1 at 50KD was detected using rabbit anti- AP2M1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of AP2M1 expression in rat kidney extract (lane 1), NIH3T3 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). AP2M1 at 50KD was detected using rabbit anti- AP2M1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-AP2M1 antibody
Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection.
Background: AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: AP2M1 adaptor-related protein complex 2, mu 1 subunit".
2. Druck T, Gu Y, Prabhala G, Cannizzaro LA, Park SH, Huebner K, Keen JH (Nov 1995). "Chromosome localization of human genes for clathrin adaptor polypeptides AP2 beta and AP50 and the clathrin-binding protein, VCP". Genomics. 30 (1): 94-7.
3. Follows ER, McPheat JC, Minshull C, Moore NC, Pauptit RA, Rowsell S, Stacey CL, Stanway JJ, Taylor IW, Abbott WM (Oct 2001). "Study of the interaction of the medium chain mu 2 subunit of the clathrin-associated adapter protein complex 2 with cytotoxic T-lymphocyte antigen 4 and CD28". The Biochemical Journal. 359 (Pt 2): 427-34.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,389 Da
NCBI Official Full Name
AP-2 complex subunit mu isoform b
NCBI Official Synonym Full Names
adaptor related protein complex 2 mu 1 subunit
NCBI Official Symbol
AP2M1
NCBI Official Synonym Symbols
mu2; AP50; CLAPM1
NCBI Protein Information
AP-2 complex subunit mu
UniProt Protein Name
AP-2 complex subunit mu
UniProt Gene Name
AP2M1
UniProt Synonym Gene Names
CLAPM1; KIAA0109

NCBI Description

This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Uniprot Description

AP2M1: a protein of the adaptor complexes medium subunit family. A subunit of the heterotetrameric coat assembly protein complex 2 (AP2) which links clathrin to receptors in coated vesicles. Interacts with the cytoplasmic tails of membrane proteins and polyphosphoinositide-containing lipids. Is not required for clathrin-coated vesicle formation at the plasma membrane, but that it is one of several endocytic adaptors required for the uptake of certain cargo proteins. Is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP-2 is a heterotetramer composed of two large chains (alpha and beta), a medium chain (AP50) and a small chain (AP17).

Protein type: Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: AP-2 adaptor complex; cytosol; lysosomal membrane; plasma membrane

Molecular Function: low-density lipoprotein receptor binding; protein binding; signal sequence binding; transporter activity

Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class II; ephrin receptor signaling pathway; microtubule-based movement; negative regulation of epidermal growth factor receptor signaling pathway; regulation of defense response to virus by virus; Wnt receptor signaling pathway, planar cell polarity pathway

Research Articles on AP2M1

Similar Products

Product Notes

The AP2M1 ap2m1 (Catalog #AAA178700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-AP2M1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AP2M1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the AP2M1 ap2m1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP2M1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.