Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ACSL5 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ACSL5 at 76KD was detected using rabbit anti- ACSL5 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Mouse, Rat ACSL5 Polyclonal Antibody | anti-ACSL5 antibody

Anti-ACSL5 Antibody

Gene Names
ACSL5; ACS2; ACS5; FACL5
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ACSL5; Polyclonal Antibody; Anti-ACSL5 Antibody; ACS2; ACS5; Acyl CoA synthetase 5; FACL5; LACS 5; Q9ULC5; Long-chain-fatty-acid--CoA ligase 5; acyl-CoA synthetase long-chain family member 5; anti-ACSL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
739
Applicable Applications for anti-ACSL5 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ACSL5 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ACSL5 at 76KD was detected using rabbit anti- ACSL5 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ACSL5 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ACSL5 at 76KD was detected using rabbit anti- ACSL5 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ACSL5 antibody
Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection.
Background: Long-chain-fatty-acid—CoA ligase 5 is an enzyme that in humans is encoded by the ACSL5 gene. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
References
1. "Entrez Gene: ACSL5 acyl-CoA synthetase long-chain family member 5".
2. Yamashita Y, Kumabe T, Cho YY, Watanabe M, Kawagishi J, Yoshimoto T, Fujino T, Kang MJ, Yamamoto TT (Dec 2000). "Fatty acid induced glioma cell growth is mediated by the acyl-CoA synthetase 5 gene located on chromosome 10q25.1-q25.2, a region frequently deleted in malignant gliomas". Oncogene. 19 (51): 5919-25.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,278 Da
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 5 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long-chain family member 5
NCBI Official Symbol
ACSL5
NCBI Official Synonym Symbols
ACS2; ACS5; FACL5
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 5
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 5
UniProt Gene Name
ACSL5
UniProt Synonym Gene Names
ACS5; FACL5; LACS 5

NCBI Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ACSL5: Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids. It was suggested that it may also stimulate fatty acid oxidation. At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. Belongs to the ATP-dependent AMP-binding enzyme family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.2.1.3; Ligase; Lipid Metabolism - fatty acid; Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 10q25.2

Cellular Component: endoplasmic reticulum membrane; membrane; mitochondrion; nucleolus; nucleus

Molecular Function: long-chain-fatty-acid-CoA ligase activity

Research Articles on ACSL5

Similar Products

Product Notes

The ACSL5 acsl5 (Catalog #AAA178694) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ACSL5 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ACSL5 acsl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACSL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.