Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: AURKBSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit anti-Human AURKB Polyclonal Antibody | anti-AURKB antibody

AURKB Antibody - middle region

Gene Names
AURKB; AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AURKB; Polyclonal Antibody; AURKB Antibody - middle region; anti-AURKB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIH
Sequence Length
344
Applicable Applications for anti-AURKB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AURKB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: AURKBSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: AURKBSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: AURKBSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AURKBSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AURKB antibody
This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-AURKB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
aurora kinase B isoform 2
NCBI Official Synonym Full Names
aurora kinase B
NCBI Official Symbol
AURKB
NCBI Official Synonym Symbols
AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
NCBI Protein Information
aurora kinase B
UniProt Protein Name
Aurora kinase B
Protein Family
UniProt Gene Name
AURKB
UniProt Synonym Gene Names
AIK2; AIM1; AIRK2; ARK2; STK1; STK12; STK5; AIM-1; ARK-2
UniProt Entry Name
AURKB_HUMAN

NCBI Description

This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

AurB: a member of the AUR family of kinases. May be directly involved in regulating the cleavage of polar spindle microtubules and is a key regulator for the onset of cytokinesis during mitosis. Expressed during S and G2/M phase and expression is upregulated in cancer cells during M phase. Localized to the midzone of central spindle in late anaphase and concentrated into the midbody in telophase and cytokinesis. Colocalizes with gamma tubulin in the mid-body. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Overexpressed in colorectal and other cancer cell lines and thought to cause aneuploidy via histone phosphorylation.

Protein type: Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Other group; AUR family

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: spindle microtubule; spindle; spindle midzone; spindle pole centrosome; midbody; nucleus; cytosol; condensed nuclear chromosome, pericentric region; chromocenter

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; protein serine/threonine/tyrosine kinase activity; histone serine kinase activity; ATP binding

Biological Process: positive regulation of cytokinesis; spindle stabilization; spindle checkpoint; spindle midzone assembly involved in mitosis; protein amino acid autophosphorylation; regulation of chromosome segregation; negative regulation of transcription from RNA polymerase II promoter; attachment of spindle microtubules to kinetochore; protein amino acid phosphorylation; negative regulation of cytokinesis; cell proliferation; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; histone modification; abscission; mitotic cell cycle; negative regulation of protein binding; negative regulation of B cell apoptosis; aging

Research Articles on AURKB

Similar Products

Product Notes

The AURKB aurkb (Catalog #AAA3220828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AURKB Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AURKB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AURKB aurkb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIYLILEYAP RGELYKELQK SCTFDEQRTA TIMEELADAL MYCHGKKVIH. It is sometimes possible for the material contained within the vial of "AURKB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.